Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PIN1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellPIN1 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit PIN1 Polyclonal Antibody | anti-PIN1 antibody

PIN1 antibody - N-terminal region

Gene Names
PIN1; DOD; UBL5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PIN1; Polyclonal Antibody; PIN1 antibody - N-terminal region; anti-PIN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEA
Sequence Length
163
Applicable Applications for anti-PIN1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PIN1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellPIN1 is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-PIN1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellPIN1 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-PIN1 antibody
This is a rabbit polyclonal antibody against PIN1. It was validated on Western Blot

Target Description: Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene.
Product Categories/Family for anti-PIN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
NCBI Official Synonym Full Names
peptidylprolyl cis/trans isomerase, NIMA-interacting 1
NCBI Official Symbol
PIN1
NCBI Official Synonym Symbols
DOD; UBL5
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
UniProt Gene Name
PIN1
UniProt Synonym Gene Names
PPIase Pin1
UniProt Entry Name
PIN1_HUMAN

NCBI Description

Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Jun 2011]

Uniprot Description

PIN1: a member of the parvulin family of peptidyl-prolyl isomerases (PPIase), has been implicated in the G2-M transition of the cell cycle. Has two distinct functional domains: an N-terminal WW domain and a C-terminal PPlase domain. Pin1 interacts with a series of mitotic phosphoproteins, including Plk1, cdc25C and cdc27, catalyzing pSer-Pro or pThr/Pro cis/trans isomerizations. Displays a preference for an acidic residue n-terminal to the isomerized proline bond.

Protein type: Nuclear receptor co-regulator; EC 5.2.1.8; Isomerase

Chromosomal Location of Human Ortholog: 19p13

Cellular Component: nucleoplasm; cytoplasm; nuclear speck; midbody; nucleus

Molecular Function: protein binding; peptidyl-prolyl cis-trans isomerase activity; mitogen-activated protein kinase kinase binding; phosphothreonine binding; GTPase activating protein binding; phosphoserine binding

Biological Process: protein peptidyl-prolyl isomerization; positive regulation of ubiquitin-protein ligase activity; cytokine and chemokine mediated signaling pathway; regulation of mitosis; innate immune response; positive regulation of protein amino acid phosphorylation; cell cycle; negative regulation of transforming growth factor beta receptor signaling pathway; regulation of cytokinesis; negative regulation of interferon type I production

Research Articles on PIN1

Similar Products

Product Notes

The PIN1 pin1 (Catalog #AAA3215942) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIN1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PIN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PIN1 pin1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RPSGNSSSGG KNGQGEPARV RCSHLLVKHS QSRRPSSWRQ EKITRTKEEA. It is sometimes possible for the material contained within the vial of "PIN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.