Western Blot (WB)
(Western Blot analysis of SPATA9 expression in transfected 293T cell line by SPATA9 polyclonal antibody. Lane 1: SPATA9 transfected lysate (27.94kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human SPATA9 Polyclonal Antibody | anti-SPATA9 antibody
SPATA9 (Spermatogenesis-associated Protein 9, Testis Development Protein NYD-SP16)
Gene Names
SPATA9; NYD-SP16
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
SPATA9; Polyclonal Antibody; SPATA9 (Spermatogenesis-associated Protein 9; Testis Development Protein NYD-SP16); Anti -SPATA9 (Spermatogenesis-associated Protein 9; anti-SPATA9 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SPATA9.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MPIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRGLNSISRSSKSVAKLLHPQLACRLLELRDISGRLLREVNAPRQPLYNIQVRKGSLFEIISFPAKTALTSIIYASYAALIYLAVCVNAVLKKVKNIFQEEESIRQNREESENCRKAFSEPVLSEPMFAEGEIKAKPYRSLPEKPDISDYPKLLANKQSNNIQVLHSVFDQSAEMNEQI
Applicable Applications for anti-SPATA9 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human SPATA9, aa1-254 (NP_114158.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of SPATA9 expression in transfected 293T cell line by SPATA9 polyclonal antibody. Lane 1: SPATA9 transfected lysate (27.94kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of SPATA9 expression in transfected 293T cell line by SPATA9 polyclonal antibody. Lane 1: SPATA9 transfected lysate (27.94kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SPATA9 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
28,740 Da
NCBI Official Full Name
SPATA9 protein
NCBI Official Synonym Full Names
spermatogenesis associated 9
NCBI Official Symbol
SPATA9
NCBI Official Synonym Symbols
NYD-SP16
NCBI Protein Information
spermatogenesis-associated protein 9; testis development protein NYD-SP16
UniProt Protein Name
Spermatogenesis-associated protein 9
Protein Family
UniProt Gene Name
SPATA9
UniProt Entry Name
SPAT9_HUMAN
Uniprot Description
SPATA9: May play a role in testicular development/spermatogenesis and may be an important factor in male infertility. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 5q15
Cellular Component: integral to membrane
Biological Process: multicellular organismal development; spermatogenesis; cell differentiation
Research Articles on SPATA9
Similar Products
Product Notes
The SPATA9 spata9 (Catalog #AAA6007705) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SPATA9 (Spermatogenesis-associated Protein 9, Testis Development Protein NYD-SP16) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPATA9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the SPATA9 spata9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPIKPVGWIC GQVLKNFSGR IEGIQKAIMD LVDEFKDEFP TILRLSQSNQ KREPAQKTSK IRMAIALAKI NRATLIRGLN SISRSSKSVA KLLHPQLACR LLELRDISGR LLREVNAPRQ PLYNIQVRKG SLFEIISFPA KTALTSIIYA SYAALIYLAV CVNAVLKKVK NIFQEEESIR QNREESENCR KAFSEPVLSE PMFAEGEIKA KPYRSLPEKP DISDYPKLLA NKQSNNIQVL HSVFDQSAEM NEQI. It is sometimes possible for the material contained within the vial of "SPATA9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
