Western Blot (WB)
(BOLL rabbit polyclonal antibody. Western Blot analysis of BOLL expression in mouse testis.)
Rabbit anti-Human, Mouse BOLL Polyclonal Antibody | anti-BOLL antibody
BOLL (Protein Boule-like, BOULE)
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
BOLL; Polyclonal Antibody; BOLL (Protein Boule-like; BOULE); Anti -BOLL (Protein Boule-like; anti-BOLL antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human BOLL. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
METESGPQTSNQMQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY
Applicable Applications for anti-BOLL antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human BOLL, aa1-295 (NP_932074.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(BOLL rabbit polyclonal antibody. Western Blot analysis of BOLL expression in mouse testis.)
Western Blot (WB)
(BOLL rabbit polyclonal antibody. Western Blot analysis of BOLL expression in mouse testis.)
Western Blot (WB)
(Western Blot analysis of BOLL expression in transfected 293T cell line by BOLL polyclonal antibody. Lane 1: BOLL transfected lysate (32.6kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of BOLL expression in transfected 293T cell line by BOLL polyclonal antibody. Lane 1: BOLL transfected lysate (32.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-BOLL antibody
Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation.
Product Categories/Family for anti-BOLL antibody
NCBI and Uniprot Product Information
Uniprot Description
Function: Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation
By similarity.
Subunit structure: Interacts with DAZ1 and DAZL. Ref.1
Subcellular location: Cytoplasm Ref.1 Ref.2.
Tissue specificity: Testis specific. Not expressed in early embryos, primordial germ cells and spermatogonial cells. First expressed in the cytoplasm of spermatocytes and then persists through meiosis. Ref.1 Ref.2
Sequence similarities: Belongs to the RRM DAZ family.Contains 1 DAZ-like domain.Contains 1 RRM (RNA recognition motif) domain.
Similar Products
Product Notes
The BOLL boll (Catalog #AAA647160) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BOLL (Protein Boule-like, BOULE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's BOLL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the BOLL boll for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: METESGPQTS NQMQTDSLSP SPNPVSPVPL NNPTSAPRYG TVIPNRIFVG GIDFKTNESD LRKFFSQYGS VKEVKIVNDR AGVSKGYGFV TFETQEDAQK ILQEAEKLNY KDKKLNIGPA IRKQQVGIPR SSIMPAAGTM YLTTSTGYPY TYHNGVAYFH TPEVTSVPPP WPSRSVCSSP VMVAQPIYQQ PAYHYQATTQ YLPGQWQWSV PQPSASSAPF LYLQPSEVIY QPVEIAQDGG CVPPPLSLME TSVPEPYSDH GVQATYHQVY APSAITMPAP VMQPEPIKTV WSIHY. It is sometimes possible for the material contained within the vial of "BOLL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
