Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CST8 expression in transfected 293T cell line by CST8 polyclonal antibody. Lane 1: CST8 transfected lysate (9.9kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human CST8 Polyclonal Antibody | anti-CST8 antibody

CST8 (CRES, Cystatin-8, Cystatin-related Epididymal Spermatogenic Protein)

Gene Names
CST8; CRES; CTES5
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CST8; Polyclonal Antibody; CST8 (CRES; Cystatin-8; Cystatin-related Epididymal Spermatogenic Protein); Anti -CST8 (CRES; anti-CST8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CST8.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDA
Applicable Applications for anti-CST8 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human CST8, aa1-90 (AAH69536.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CST8 expression in transfected 293T cell line by CST8 polyclonal antibody. Lane 1: CST8 transfected lysate (9.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CST8 expression in transfected 293T cell line by CST8 polyclonal antibody. Lane 1: CST8 transfected lysate (9.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CST8 antibody
Performs a specialized role during sperm development and maturation.
Product Categories/Family for anti-CST8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,275 Da
NCBI Official Full Name
cystatin-8
NCBI Official Synonym Full Names
cystatin 8 (cystatin-related epididymal specific)
NCBI Official Symbol
CST8
NCBI Official Synonym Symbols
CRES; CTES5
NCBI Protein Information
cystatin-8; cystatin-related epididymal spermatogenic protein
UniProt Protein Name
Cystatin-8
Protein Family
UniProt Gene Name
CST8
UniProt Synonym Gene Names
CRES
UniProt Entry Name
CST8_HUMAN

NCBI Description

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein similar to type 2 cystatins. The encoded protein exhibits highly tissue-specific expression in the reproductive tract, suggesting implicit roles in reproduction. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]

Uniprot Description

CST8: Performs a specialized role during sperm development and maturation. Belongs to the cystatin family.

Protein type: Inhibitor; Secreted; Cell surface; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 20p11.21

Cellular Component: cell surface; cytoplasm; extracellular region

Molecular Function: cysteine protease inhibitor activity

Research Articles on CST8

Similar Products

Product Notes

The CST8 cst8 (Catalog #AAA6004044) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CST8 (CRES, Cystatin-8, Cystatin-related Epididymal Spermatogenic Protein) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CST8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the CST8 cst8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQEYNKESED KYVFLVVKTL QAQLQVTNLL EYLIDVEIAR SDCRKPLSTN EICAIQENSK LKRKLSCSFL VGALPWNGEF TVMEKKCEDA. It is sometimes possible for the material contained within the vial of "CST8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.