Western Blot (WB)
(SPATA9 antibody (MBS5302174) used at 1 ug/ml to detect target protein.)
Rabbit SPATA9 Polyclonal Antibody | anti-SPATA9 antibody
SPATA9 antibody
Gene Names
SPATA9; NYD-SP16
Applications
Western Blot
Purity
Affinity purified
Synonyms
SPATA9; Polyclonal Antibody; SPATA9 antibody; Polyclonal SPATA9; Anti-SPATA9; Spermatogenesis Associated 9; SPATA-9; SPATA 9; FLJ35906; NYD-SP16; anti-SPATA9 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
SPATA9 antibody was raised against the N terminal of SPATA9
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPATA9 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
135
Applicable Applications for anti-SPATA9 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
SPATA9 may play a role in testicular development/spermatogenesis and may be an important factor in male infertility. Defects in expression of SPATA9 lead to Sertoli-cell-only syndrome.
Cross-Reactivity
Human
Immunogen
SPATA9 antibody was raised using the N terminal of SPATA9 corresponding to a region with amino acids PIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(SPATA9 antibody (MBS5302174) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(SPATA9 antibody (MBS5302174) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-SPATA9 antibody
Rabbit polyclonal SPATA9 antibody raised against the N terminal of SPATA9
Product Categories/Family for anti-SPATA9 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
29 kDa (MW of target protein)
NCBI Official Full Name
SPATA9 protein
NCBI Official Synonym Full Names
spermatogenesis associated 9
NCBI Official Symbol
SPATA9
NCBI Official Synonym Symbols
NYD-SP16
NCBI Protein Information
spermatogenesis-associated protein 9
UniProt Protein Name
Spermatogenesis-associated protein 9
Protein Family
UniProt Gene Name
SPATA9
UniProt Entry Name
SPAT9_HUMAN
Uniprot Description
SPATA9: May play a role in testicular development/spermatogenesis and may be an important factor in male infertility. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 5q15
Cellular Component: integral to membrane
Biological Process: multicellular organismal development; spermatogenesis; cell differentiation
Research Articles on SPATA9
Similar Products
Product Notes
The SPATA9 spata9 (Catalog #AAA5302174) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SPATA9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the SPATA9 spata9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SPATA9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
