Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SPANXC AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

Rabbit anti-Human SPANXC Polyclonal Antibody | anti-SPANXC antibody

SPANXC antibody - N-terminal region

Gene Names
SPANXC; CTp11; CT11.3; SPANXE; SPANX-C; SPANX-E
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SPANXC; Polyclonal Antibody; SPANXC antibody - N-terminal region; anti-SPANXC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EVNETMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNVKRTSPEELLN
Sequence Length
97
Applicable Applications for anti-SPANXC antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SPANXC AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

Western Blot (WB) (WB Suggested Anti-SPANXC AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Related Product Information for anti-SPANXC antibody
This is a rabbit polyclonal antibody against SPANXC. It was validated on Western Blot

Target Description: Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family, which is located in a gene cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene encodes a protein that localizes to the nucleus and is expressed in highly metastatic cell lines, making the protein a potential prognostic marker. The protein belongs to a family of cancer/testis antigens and represents a potential target for cancer immunotherapy.
Product Categories/Family for anti-SPANXC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
sperm protein associated with the nucleus on the X chromosome C
NCBI Official Synonym Full Names
SPANX family member C
NCBI Official Symbol
SPANXC
NCBI Official Synonym Symbols
CTp11; CT11.3; SPANXE; SPANX-C; SPANX-E
NCBI Protein Information
sperm protein associated with the nucleus on the X chromosome C
UniProt Protein Name
Sperm protein associated with the nucleus on the X chromosome C
UniProt Gene Name
SPANXC
UniProt Synonym Gene Names
CT11.3; SPANX-C
UniProt Entry Name
SPNXC_HUMAN

NCBI Description

Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family, which is located in a gene cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene encodes a protein that localizes to the nucleus and is expressed in highly metastatic cell lines, making the protein a potential diagnostic and prognostic marker. The protein belongs to a family of cancer/testis antigens and represents a potential target for cancer immunotherapy. [provided by RefSeq, Jul 2008]

Uniprot Description

SPANXC: Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family, which is located in a gene cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene encodes a protein that localizes to the nucleus and is expressed in highly metastatic cell lines, making the protein a potential diagnostic and prognostic marker. The protein belongs to a family of cancer/testis antigens and represents a potential target for cancer immunotherapy. [provided by RefSeq, Jul 2008]

Protein type: Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: Xq27.1

Cellular Component: cytoplasm; nucleus

Research Articles on SPANXC

Similar Products

Product Notes

The SPANXC spanxc (Catalog #AAA3214560) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPANXC antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPANXC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPANXC spanxc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EVNETMPETP TGDSDPQPAP KKMKTSESST ILVVRYRRNV KRTSPEELLN. It is sometimes possible for the material contained within the vial of "SPANXC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.