Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-RCAN1 / DSCR1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Brain, cerebellumObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit RCAN1 Polyclonal Antibody | anti-RCAN1 antibody

RCAN1 antibody - N-terminal region

Gene Names
RCAN1; CSP1; DSC1; RCN1; DSCR1; MCIP1; ADAPT78
Reactivity
Dog, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RCAN1; Polyclonal Antibody; RCAN1 antibody - N-terminal region; anti-RCAN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWS
Sequence Length
252
Applicable Applications for anti-RCAN1 antibody
Western Blot (WB)
Homology
Dog: 93%; Human: 100%; Mouse: 77%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RCAN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-RCAN1 / DSCR1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Brain, cerebellumObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-RCAN1 / DSCR1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Brain, cerebellumObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-RCAN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-RCAN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)
Related Product Information for anti-RCAN1 antibody
This is a rabbit polyclonal antibody against RCAN1. It was validated on Western Blot

Target Description: RCAN1 interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
calcipressin-1 isoform a
NCBI Official Synonym Full Names
regulator of calcineurin 1
NCBI Official Symbol
RCAN1
NCBI Official Synonym Symbols
CSP1; DSC1; RCN1; DSCR1; MCIP1; ADAPT78
NCBI Protein Information
calcipressin-1
UniProt Protein Name
Calcipressin-1
Protein Family
UniProt Gene Name
RCAN1
UniProt Synonym Gene Names
ADAPT78; CSP1; DSC1; DSCR1; MCIP1
UniProt Entry Name
RCAN1_HUMAN

NCBI Description

The protein encoded by this gene interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013]

Uniprot Description

RCAN1: Inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. Could play a role during central nervous system development. Interacts with RAF1. By calcium. Highly expressed heart, brain and skeletal muscle. Also expressed in all other tissues. Belongs to the RCAN family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Inhibitor

Chromosomal Location of Human Ortholog: 21q22.12

Cellular Component: nucleus

Molecular Function: identical protein binding; protein binding; DNA binding; transcription factor activity

Biological Process: central nervous system development; regulation of transcription, DNA-dependent; blood circulation; calcium-mediated signaling; signal transduction

Research Articles on RCAN1

Similar Products

Product Notes

The RCAN1 rcan1 (Catalog #AAA3213600) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RCAN1 antibody - N-terminal region reacts with Dog, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RCAN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RCAN1 rcan1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEDGVAGPQL GAAAEAAEAA EARARPGVTL RPFAPLSGAA EADEGGGDWS. It is sometimes possible for the material contained within the vial of "RCAN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.