Western Blot (WB)
(Western blot-SOGA1 Polyclonal Antibody)
Rabbit SOGA1 Polyclonal Antibody | anti-SOGA1 antibody
SOGA1 Polyclonal Antibody
Gene Names
SOGA1; SOGA; KIAA0889; C20orf117
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
SOGA1; Polyclonal Antibody; SOGA1 Polyclonal Antibody; C20orf117; KIAA0889; SOGA; protein SOGA1; anti-SOGA1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.29 mg/ml (varies by lot)
Sequence Length
1016
Applicable Applications for anti-SOGA1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 650-750 of human SOGA1 (NP_542194.2).
Immunogen Sequence
AEVLPGLREQAALVSKAIDVLVADANGFTAGLRLCLDNECADFRLHEAPDNSEGPRDTKLIHAILVRLSVLQQELNAFTRKADAVLGCSVKEQQESFSSLP
Positive Samples
Mouse Liver, Mouse Brain, Mouse Lung, Rat Liver, Rat Brain
Cellular Location
Secreted
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot-SOGA1 Polyclonal Antibody)
Western Blot (WB)
(Western blot-SOGA1 Polyclonal Antibody)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 55kDa; 115kDa; 159kDa; 183kDa
Observed: 80kDa
Observed: 80kDa
NCBI Official Full Name
protein SOGA1 isoform 2
NCBI Official Synonym Full Names
suppressor of glucose, autophagy associated 1
NCBI Official Symbol
SOGA1
NCBI Official Synonym Symbols
SOGA; KIAA0889; C20orf117
NCBI Protein Information
protein SOGA1
UniProt Protein Name
Protein SOGA1
Protein Family
UniProt Gene Name
SOGA1
UniProt Synonym Gene Names
C20orf117; KIAA0889; SOGA; 80-kDa SOGA fragment
UniProt Entry Name
SOGA1_HUMAN
Uniprot Description
SOGA1: Regulates autophagy by playing a role in the reduction of glucose production in an adiponectin- and insulin-dependent manner. Belongs to the SOGA family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Autophagy
Chromosomal Location of Human Ortholog: 20q11.23
Cellular Component: extracellular space
Biological Process: negative regulation of gluconeogenesis; insulin receptor signaling pathway; regulation of autophagy
Similar Products
Product Notes
The SOGA1 soga1 (Catalog #AAA9140936) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOGA1 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SOGA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the SOGA1 soga1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SOGA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
