Western Blot (WB)
(Host: RabbitTarget Name: SOGA1Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/mlSOGA1 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Rabbit SOGA1 Polyclonal Antibody | anti-SOGA1 antibody
SOGA1 Antibody - C-terminal region
Gene Names
SOGA1; SOGA; KIAA0889; C20orf117
Reactivity
Guinea Pig, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SOGA1; Polyclonal Antibody; SOGA1 Antibody - C-terminal region; anti-SOGA1 antibody
Host
Rabbit
Reactivity
Guinea Pig, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EPGDPEKDTKEKPGLSSRDCNHLGALACQDPPGRQMQRSYTAPDKTGIRV
Sequence Length
518
Applicable Applications for anti-SOGA1 antibody
Western Blot (WB)
Homology
Guinea Pig: 82%; Human: 100%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SOGA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SOGA1Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/mlSOGA1 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Western Blot (WB)
(Host: RabbitTarget Name: SOGA1Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/mlSOGA1 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Related Product Information for anti-SOGA1 antibody
This is a rabbit polyclonal antibody against SOGA1. It was validated on Western Blot
Target Description: SOGA1 regulates autophagy by playing a role in the reduction of glucose production in an adiponectin- and insulin-dependent manner.
Target Description: SOGA1 regulates autophagy by playing a role in the reduction of glucose production in an adiponectin- and insulin-dependent manner.
Product Categories/Family for anti-SOGA1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
protein SOGA1 isoform 2
NCBI Official Synonym Full Names
suppressor of glucose, autophagy associated 1
NCBI Official Symbol
SOGA1
NCBI Official Synonym Symbols
SOGA; KIAA0889; C20orf117
NCBI Protein Information
protein SOGA1
UniProt Protein Name
Protein SOGA1
Protein Family
UniProt Gene Name
SOGA1
UniProt Synonym Gene Names
C20orf117; KIAA0889; SOGA; 80-kDa SOGA fragment
UniProt Entry Name
SOGA1_HUMAN
Uniprot Description
SOGA1: Regulates autophagy by playing a role in the reduction of glucose production in an adiponectin- and insulin-dependent manner. Belongs to the SOGA family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Autophagy
Chromosomal Location of Human Ortholog: 20q11.23
Cellular Component: extracellular space
Biological Process: negative regulation of gluconeogenesis; insulin receptor signaling pathway; regulation of autophagy
Similar Products
Product Notes
The SOGA1 soga1 (Catalog #AAA3218564) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOGA1 Antibody - C-terminal region reacts with Guinea Pig, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SOGA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SOGA1 soga1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EPGDPEKDTK EKPGLSSRDC NHLGALACQD PPGRQMQRSY TAPDKTGIRV. It is sometimes possible for the material contained within the vial of "SOGA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
