Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SNCA expression in transfected 293T cell line by SNCA polyclonal antibody. Lane 1: SNCA transfected lysate (14.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SNCA Polyclonal Antibody | anti-SNCA antibody

SNCA (NACP, PARK1, Alpha-synuclein, Non-A beta Component of AD Amyloid, Non-A4 Component of Amyloid Precursor, MGC110988) (AP)

Gene Names
SNCA; PD1; NACP; PARK1; PARK4
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SNCA; Polyclonal Antibody; SNCA (NACP; PARK1; Alpha-synuclein; Non-A beta Component of AD Amyloid; Non-A4 Component of Amyloid Precursor; MGC110988) (AP); anti-SNCA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SNCA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SNCA antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SNCA, aa1-140 (NP_000336.1).
Immunogen Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SNCA expression in transfected 293T cell line by SNCA polyclonal antibody. Lane 1: SNCA transfected lysate (14.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SNCA expression in transfected 293T cell line by SNCA polyclonal antibody. Lane 1: SNCA transfected lysate (14.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between SNCA and APP. HeLa cells were stained with SNCA rabbit purified polyclonal 1:1200 and APP mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between SNCA and APP. HeLa cells were stained with SNCA rabbit purified polyclonal 1:1200 and APP mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-SNCA antibody
Alpha-synuclein is a member of the synuclein family, which also includes beta-and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha-and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease.
Product Categories/Family for anti-SNCA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,460 Da
NCBI Official Full Name
alpha-synuclein isoform NACP140
NCBI Official Synonym Full Names
synuclein, alpha (non A4 component of amyloid precursor)
NCBI Official Symbol
SNCA
NCBI Official Synonym Symbols
PD1; NACP; PARK1; PARK4
NCBI Protein Information
alpha-synuclein; synuclein alpha-140; non A-beta component of AD amyloid
UniProt Protein Name
Alpha-synuclein
Protein Family
UniProt Gene Name
SNCA
UniProt Synonym Gene Names
NACP; PARK1; NACP
UniProt Entry Name
SYUA_HUMAN

NCBI Description

Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Four alternatively spliced transcripts encoding two different isoforms have been identified for this gene. [provided by RefSeq, Mar 2009]

Uniprot Description

SNCA: a member of the synuclein family. Abundantly expressed in the brain. Inhibits phospholipase D2 selectively. May integrate presynaptic signaling and membrane trafficking. Implicated in the pathogenesis of Parkinson's disease. A major component of amyloid plaques in the brains of patients with Alzheimer's disease. Two alternatively spliced isoforms transcripts have been identified.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: Golgi apparatus; nuclear outer membrane; rough endoplasmic reticulum; mitochondrion; lysosome; extracellular region; fibril; terminal button; cell cortex; inclusion body; cytosol; mitochondrial respiratory chain complex I; actin cytoskeleton; synaptic vesicle; platelet alpha granule membrane; growth cone; perinuclear region of cytoplasm; axon; cytoplasm; plasma membrane; ribosome; cell junction; nucleus

Molecular Function: protein domain specific binding; identical protein binding; histone binding; zinc ion binding; kinesin binding; microtubule binding; ferrous iron binding; caspase inhibitor activity; magnesium ion binding; beta-tubulin binding; phosphoprotein binding; protein N-terminus binding; oxidoreductase activity; Hsp70 protein binding; calcium ion binding; dynein binding; protein binding; phospholipase binding; copper ion binding; phospholipid binding; fatty acid binding; tau protein binding; alpha-tubulin binding

Biological Process: regulation of acyl-CoA biosynthetic process; adult locomotory behavior; positive regulation of apoptosis; positive regulation of endocytosis; response to lipopolysaccharide; dopamine biosynthetic process; positive regulation of neurotransmitter secretion; calcium ion homeostasis; response to magnesium ion; fibril organization and biogenesis; synapse organization and biogenesis; dopamine uptake; negative regulation of neuron apoptosis; response to drug; negative regulation of dopamine metabolic process; synaptic vesicle endocytosis; negative regulation of transporter activity; negative regulation of apoptosis; regulation of long-term neuronal synaptic plasticity; negative regulation of serotonin uptake; mitochondrial membrane organization and biogenesis; negative regulation of norepinephrine uptake; microglial cell activation; negative regulation of transcription from RNA polymerase II promoter; negative regulation of caspase activity; negative regulation of monooxygenase activity; fatty acid metabolic process; regulation of dopamine secretion; negative regulation of dopamine uptake; negative regulation of histone acetylation; negative regulation of exocytosis; negative regulation of protein amino acid phosphorylation; behavioral response to cocaine; phospholipid metabolic process; receptor internalization; response to iron(II) ion; positive regulation of receptor recycling; aging; caspase activation; neutral lipid metabolic process; protein destabilization; regulation of macrophage activation; regulation of glutamate secretion; negative regulation of microtubule polymerization; positive regulation of peptidyl-serine phosphorylation; organelle ATP synthesis coupled electron transport; regulation of locomotion; positive regulation of release of sequestered calcium ion into cytosol; regulation of excitatory postsynaptic membrane potential

Disease: Parkinson Disease 4, Autosomal Dominant; Parkinson Disease 1, Autosomal Dominant; Dementia, Lewy Body

Research Articles on SNCA

Similar Products

Product Notes

The SNCA snca (Catalog #AAA6394586) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNCA (NACP, PARK1, Alpha-synuclein, Non-A beta Component of AD Amyloid, Non-A4 Component of Amyloid Precursor, MGC110988) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNCA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SNCA snca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SNCA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.