Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SMUG1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysateSMUG1 is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit SMUG1 Polyclonal Antibody | anti-SMUG1 antibody

SMUG1 antibody - middle region

Gene Names
SMUG1; FDG; UNG3; HMUDG
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SMUG1; Polyclonal Antibody; SMUG1 antibody - middle region; anti-SMUG1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHC
Sequence Length
270
Applicable Applications for anti-SMUG1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 91%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SMUG1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SMUG1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysateSMUG1 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (WB Suggested Anti-SMUG1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysateSMUG1 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-SMUG1 antibody
This is a rabbit polyclonal antibody against SMUG1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
single-strand selective monofunctional uracil DNA glycosylase isoform 1
NCBI Official Synonym Full Names
single-strand-selective monofunctional uracil-DNA glycosylase 1
NCBI Official Symbol
SMUG1
NCBI Official Synonym Symbols
FDG; UNG3; HMUDG
NCBI Protein Information
single-strand selective monofunctional uracil DNA glycosylase
UniProt Protein Name
Single-strand selective monofunctional uracil DNA glycosylase
UniProt Gene Name
SMUG1
UniProt Entry Name
SMUG1_HUMAN

NCBI Description

This gene encodes a protein that participates in base excision repair by removing uracil from single- and double-stranded DNA. Many alternatively spliced transcript variants exist for this gene; the full-length nature is known for some but not all of the variants. [provided by RefSeq, Aug 2011]

Uniprot Description

SMUG1: Responsible for recognizing base lesions in the genome and initiating base excision DNA repair. Acts as a monofunctional DNA glycosylase specific for uracil (U) residues in DNA and has a preference for single-stranded DNA substrates. The activity is greater against mismatches (U/G) than against matches (U/A). Excised uracil (U), 5-formyluracil (fU) and uracil derivatives bearing an oxidized group at C5 [5-hydroxyuracil (hoU) and 5- hydroxymethyluracil (hmU)] in ssDNA and dsDNA but not analogous cytosine derivatives (5-hydroxycytosine and 5-formylcytosine) and other oxidized damage. The activity is damage specificity and salt concentration-dependent. The general order of the preference for ssDNA and dsDNA is the following: ssDNA > dsDNA (G pair) = dsDNA (A pair) at the low salt concentration. At the high concentration dsDNA (G pair) > dsDNA (A pair) > ssDNA. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA repair, damage; Hydrolase; EC 3.2.2.-

Chromosomal Location of Human Ortholog: 12q13.13

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; nucleolus

Molecular Function: single-strand selective uracil DNA N-glycosylase activity; protein binding; uracil DNA N-glycosylase activity; DNA binding; oxidized pyrimidine base lesion DNA N-glycosylase activity; DNA N-glycosylase activity

Biological Process: base-excision repair, AP site formation; base-excision repair; depyrimidination; DNA repair; DNA catabolic process, endonucleolytic

Research Articles on SMUG1

Similar Products

Product Notes

The SMUG1 smug1 (Catalog #AAA3211998) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMUG1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SMUG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SMUG1 smug1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IVGPVLTPPQ EHPKRPVLGL ECPQSEVSGA RFWGFFRNLC GQPEVFFHHC. It is sometimes possible for the material contained within the vial of "SMUG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.