Immunohistochemistry (IHC)
(Rabbit Anti-SMNDC1 antibodyParaffin Embedded Tissue: Human Lung cell Cellular Data: alveolar cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Rabbit SMNDC1 Polyclonal Antibody | anti-SMNDC1 antibody
SMNDC1 antibody - middle region
Gene Names
SMNDC1; SMNR; SPF30; TDRD16C
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SMNDC1; Polyclonal Antibody; SMNDC1 antibody - middle region; anti-SMNDC1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSK
Sequence Length
238
Applicable Applications for anti-SMNDC1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SMNDC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Rabbit Anti-SMNDC1 antibodyParaffin Embedded Tissue: Human Lung cell Cellular Data: alveolar cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Immunohistochemistry (IHC)
(Rabbit Anti-SMNDC1 antibodyParaffin Embedded Tissue: Human Lung cell Cellular Data: alveolar cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Western Blot (WB)
(WB Suggested Anti-SMNDC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)
Western Blot (WB)
(WB Suggested Anti-SMNDC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)
Related Product Information for anti-SMNDC1 antibody
This is a rabbit polyclonal antibody against SMNDC1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. SMNDC1 is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene. This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. The protein encoded by this gene is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene.
Target Description: This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. SMNDC1 is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene. This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. The protein encoded by this gene is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene.
Product Categories/Family for anti-SMNDC1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
survival of motor neuron-related-splicing factor 30
NCBI Official Synonym Full Names
survival motor neuron domain containing 1
NCBI Official Symbol
SMNDC1
NCBI Official Synonym Symbols
SMNR; SPF30; TDRD16C
NCBI Protein Information
survival of motor neuron-related-splicing factor 30
UniProt Protein Name
Survival of motor neuron-related-splicing factor 30
Protein Family
UniProt Gene Name
SMNDC1
UniProt Synonym Gene Names
SMNR; SPF30
UniProt Entry Name
SPF30_HUMAN
NCBI Description
This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. The protein encoded by this gene is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene. [provided by RefSeq, Jul 2008]
Uniprot Description
SPF30: Necessary for spliceosome assembly. Overexpression causes apoptosis. Belongs to the SMN family.
Protein type: Spliceosome; RNA processing; RNA splicing; RNA-binding
Chromosomal Location of Human Ortholog: 10q23
Cellular Component: nucleoplasm; spliceosome; Cajal body; intermediate filament cytoskeleton; cytoplasm; nuclear speck; nucleus
Molecular Function: protein binding
Biological Process: RNA splicing, via transesterification reactions; apoptosis; RNA splicing; spliceosome assembly; mRNA processing
Research Articles on SMNDC1
Similar Products
Product Notes
The SMNDC1 smndc1 (Catalog #AAA3205358) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMNDC1 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SMNDC1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SMNDC1 smndc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QFNNRAYSKN KKGQVKRSIF ASPESVTGKV GVGTCGIADK PMTQYQDTSK. It is sometimes possible for the material contained within the vial of "SMNDC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
