Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SMC5Sample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 3ug/ml)

Rabbit anti-Human SMC5 Polyclonal Antibody | anti-SMC5 antibody

SMC5 Antibody-C-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SMC5; Polyclonal Antibody; SMC5 Antibody-C-terminal region; Structural maintenance of chromosomes protein 5; SMC5L1; anti-SMC5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
MATPSKKTSTPSPQPSKRALPRDPSSEVPSKRKNSAPQLPLLQSSGPFVE
Applicable Applications for anti-SMC5 antibody
Western Blot (WB)
Protein Size
1101 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SMC5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SMC5Sample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 3ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SMC5Sample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 3ug/ml)
Related Product Information for anti-SMC5 antibody
Description of Target: Core component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). Required for recruitment of telomeres to PML nuclear bodies. Required for sister chromatid cohesion during prometaphase and mitotic progression; the function seems to be independent of SMC6. SMC5-SMC6 complex may prevent transcription of episomal DNA, such as circular viral DNA genome.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
121kDa
UniProt Protein Name
Structural maintenance of chromosomes protein 5
UniProt Gene Name
SMC5
UniProt Synonym Gene Names
KIAA0594; SMC5L1; SMC protein 5; SMC-5; hSMC5
UniProt Entry Name
SMC5_HUMAN

Uniprot Description

SMC5: Core component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). Required for recruitment of telomeres to PML nuclear bodies. Required for sister chromatid cohesion during prometaphase and mitotic progression; the function seems to be independent of SMC6. Belongs to the SMC family. SMC5 subfamily.

Protein type: DNA replication

Chromosomal Location of Human Ortholog: 9q21.12

Cellular Component: nucleoplasm; PML body; chromosome, telomeric region; cell junction; nucleus

Molecular Function: protein binding; ATP binding

Biological Process: mitosis; positive regulation of maintenance of mitotic sister chromatid cohesion; cell division; telomere maintenance via recombination; positive regulation of mitotic metaphase/anaphase transition; double-strand break repair via nonhomologous end joining; double-strand break repair via homologous recombination

Similar Products

Product Notes

The SMC5 smc5 (Catalog #AAA3249675) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMC5 Antibody-C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMC5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SMC5 smc5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MATPSKKTST PSPQPSKRAL PRDPSSEVPS KRKNSAPQLP LLQSSGPFVE. It is sometimes possible for the material contained within the vial of "SMC5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.