Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-NSMCE4A AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Small intestineObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit anti-Human NSMCE4A Polyclonal Antibody | anti-NSMCE4A antibody

NSMCE4A Antibody - C-terminal region

Gene Names
NSMCE4A; NS4EA; NSE4A; C10orf86
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NSMCE4A; Polyclonal Antibody; NSMCE4A Antibody - C-terminal region; anti-NSMCE4A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NEENEGFEHNTQVRNQGIIALSYRDWEIVKTFEISEPVITPSQRQQKPSA
Sequence Length
384
Applicable Applications for anti-NSMCE4A antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human NSMCE4A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-NSMCE4A AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Small intestineObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-NSMCE4A AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Small intestineObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: RabbitTarget Name: NSMCE4ASample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/mlNSMCE4A is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Western Blot (WB) (Host: RabbitTarget Name: NSMCE4ASample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/mlNSMCE4A is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
Related Product Information for anti-NSMCE4A antibody
This is a rabbit polyclonal antibody against NSMCE4A. It was validated on Western Blot

Target Description: NSMCE4A is a component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). It is involved in positive regulation of response to DNA damage stimulus.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
non-structural maintenance of chromosomes element 4 homolog A isoform 2
NCBI Official Synonym Full Names
NSE4 homolog A, SMC5-SMC6 complex component
NCBI Official Symbol
NSMCE4A
NCBI Official Synonym Symbols
NS4EA; NSE4A; C10orf86
NCBI Protein Information
non-structural maintenance of chromosomes element 4 homolog A
UniProt Protein Name
Non-structural maintenance of chromosomes element 4 homolog A
UniProt Gene Name
NSMCE4A
UniProt Synonym Gene Names
C10orf86; NS4EA
UniProt Entry Name
NSE4A_HUMAN

Uniprot Description

Function: Component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). Is involved in positive regulation of response to DNA damage stimulus. Ref.7

Subunit structure: Component of the SMC5-SMC6 complex which consists at least of SMC5, SMC6, NSMCE2, NSMCE1, NSMCE4A or EID3 and NDNL2. NSMCE1, NSMCE4A or EID3 and NDNL2 probably form a subcomplex that bridges the head domains of the SMC5:SMC6 heterodimer. Ref.7

Subcellular location: Nucleus. Chromosome › telomere

Probable Ref.7.

Sequence similarities: Belongs to the NSE4 family.

Research Articles on NSMCE4A

Similar Products

Product Notes

The NSMCE4A nsmce4a (Catalog #AAA3218682) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NSMCE4A Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NSMCE4A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NSMCE4A nsmce4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NEENEGFEHN TQVRNQGIIA LSYRDWEIVK TFEISEPVIT PSQRQQKPSA. It is sometimes possible for the material contained within the vial of "NSMCE4A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.