Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SLITRK5Sample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human SLITRK5 Polyclonal Antibody | anti-SLITRK5 antibody

SLITRK5 Antibody - middle region

Gene Names
SLITRK5; LRRC11; bA364G4.2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SLITRK5; Polyclonal Antibody; SLITRK5 Antibody - middle region; anti-SLITRK5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLFVLVMKRRKKNQSDHTSTNNSDVSSFNMQYSVYGGGGGTGGHPHAHVH
Sequence Length
167
Applicable Applications for anti-SLITRK5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLITRK5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SLITRK5Sample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SLITRK5Sample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SLITRK5 antibody
Members of the SLITRK family, such as SLITRK5, are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins (see SLIT1; MIM 603742). Most SLITRKs, including SLITRK5, also have C-terminal regions that share homology with neurotrophin receptors (see NTRK1; MIM 191315). SLITRKs are expressed predominantly in neural tissues and have neurite-modulating activity (Aruga et al., 2003 [PubMed 14557068]).[supplied by OMIM, Mar 2008]
Product Categories/Family for anti-SLITRK5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
107 kDa
NCBI Official Full Name
SLIT and NTRK-like protein 5
NCBI Official Synonym Full Names
SLIT and NTRK like family member 5
NCBI Official Symbol
SLITRK5
NCBI Official Synonym Symbols
LRRC11; bA364G4.2
NCBI Protein Information
SLIT and NTRK-like protein 5
UniProt Protein Name
SLIT and NTRK-like protein 5
UniProt Gene Name
SLITRK5
UniProt Synonym Gene Names
KIAA0918; LRRC11
UniProt Entry Name
SLIK5_HUMAN

NCBI Description

Members of the SLITRK family, such as SLITRK5, are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins (see SLIT1; MIM 603742). Most SLITRKs, including SLITRK5, also have C-terminal regions that share homology with neurotrophin receptors (see NTRK1; MIM 191315). SLITRKs are expressed predominantly in neural tissues and have neurite-modulating activity (Aruga et al., 2003 [PubMed 14557068]).[supplied by OMIM, Mar 2008]

Uniprot Description

SLITRK5: Suppresses neurite outgrowth. Belongs to the SLITRK family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 13q31.2

Cellular Component: integral to membrane; receptor complex

Biological Process: skin development; grooming behavior; synaptic transmission; response to xenobiotic stimulus; axonogenesis; striatum development; dendrite morphogenesis; adult behavior

Research Articles on SLITRK5

Similar Products

Product Notes

The SLITRK5 slitrk5 (Catalog #AAA3220611) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLITRK5 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLITRK5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLITRK5 slitrk5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLFVLVMKRR KKNQSDHTST NNSDVSSFNM QYSVYGGGGG TGGHPHAHVH. It is sometimes possible for the material contained within the vial of "SLITRK5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.