Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SLITRK1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

Rabbit SLITRK1 Polyclonal Antibody | anti-SLITRK1 antibody

SLITRK1 antibody - N-terminal region

Gene Names
SLITRK1; TTM; LRRC12
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLITRK1; Polyclonal Antibody; SLITRK1 antibody - N-terminal region; anti-SLITRK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CDLLSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRV
Sequence Length
696
Applicable Applications for anti-SLITRK1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLITRK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SLITRK1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-SLITRK1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Related Product Information for anti-SLITRK1 antibody
This is a rabbit polyclonal antibody against SLITRK1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Members of the SLITRK family, such as SLITRK1, are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins. Most SLITRKs, but not SLITRK1, also have C-terminal regions that share homology with neurotrophin receptors. SLITRKs are expressed predominantly in neural tissues and have neurite-modulating activity.Members of the SLITRK family, such as SLITRK1, are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins (see SLIT1; MIM 603742). Most SLITRKs, but not SLITRK1, also have C-terminal regions that share homology with neurotrophin receptors (see NTRK1; MIM 191315). SLITRKs are expressed predominantly in neural tissues and have neurite-modulating activity (Aruga et al., 2003 [PubMed 14557068]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-SLITRK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78kDa
NCBI Official Full Name
SLIT and NTRK-like protein 1
NCBI Official Synonym Full Names
SLIT and NTRK like family member 1
NCBI Official Symbol
SLITRK1
NCBI Official Synonym Symbols
TTM; LRRC12
NCBI Protein Information
SLIT and NTRK-like protein 1
UniProt Protein Name
SLIT and NTRK-like protein 1
UniProt Gene Name
SLITRK1
UniProt Synonym Gene Names
KIAA1910; LRRC12
UniProt Entry Name
SLIK1_HUMAN

NCBI Description

This gene encodes a member of the SLITRK protein family. Members of this family are integral membrane proteins that are characterized by two N-terminal leucine-rich repeat (LRR) domains and a C-terminal region that shares homology with trk neurotrophin receptors. However, the protein encoded by this gene lacks the region of homology to neurotrophin receptors. This protein is thought to be involved in neurite outgrowth. Mutations in this gene may be associated with Tourette syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

SLITRK1: Enhances neuronal dendrite outgrowth. Defects in SLITRK1 may be a cause of Gilles de la Tourette syndrome (GTS). GTS is a neurologic disorder manifested particularly by motor and vocal tics and associated with behavioral abnormalities. Defects in SLITRK1 may be a cause of trichotillomania (TTM). It is a neuropsychiatric disorder characterized by chronic, repetitive, or compulsive hair pulling resulting in noticeable hair loss. Affected individuals may develop physical complications and often have overlapping psychologic disorders, such as Gilles de la Tourette syndrome or obsessive-compulsive disorder. Belongs to the SLITRK family.

Protein type: Membrane protein, integral; Cell development/differentiation

Chromosomal Location of Human Ortholog: 13q31.1

Cellular Component: integral to membrane

Biological Process: axonogenesis; homeostatic process; multicellular organism growth; adult behavior

Disease: Gilles De La Tourette Syndrome; Trichotillomania

Research Articles on SLITRK1

Similar Products

Product Notes

The SLITRK1 slitrk1 (Catalog #AAA3209840) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLITRK1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SLITRK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLITRK1 slitrk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CDLLSLKEWL ENIPKNALIG RVVCEAPTRL QGKDLNETTE QDLCPLKNRV. It is sometimes possible for the material contained within the vial of "SLITRK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.