Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SLC7A2 Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysate)

Rabbit SLC7A2 Polyclonal Antibody | anti-SLC7A2 antibody

SLC7A2 antibody - middle region

Gene Names
SLC7A2; CAT2; ATRC2; HCAT2
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC7A2; Polyclonal Antibody; SLC7A2 antibody - middle region; anti-SLC7A2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATC
Sequence Length
658
Applicable Applications for anti-SLC7A2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC7A2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SLC7A2 Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysate)

Western Blot (WB) (WB Suggested Anti-SLC7A2 Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysate)
Related Product Information for anti-SLC7A2 antibody
This is a rabbit polyclonal antibody against SLC7A2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SLC7A2 is a low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). SLC7A2 plays a regulatory role in classical or alternative activation of macrophages.
Product Categories/Family for anti-SLC7A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
cationic amino acid transporter 2 isoform 2
NCBI Official Synonym Full Names
solute carrier family 7 member 2
NCBI Official Symbol
SLC7A2
NCBI Official Synonym Symbols
CAT2; ATRC2; HCAT2
NCBI Protein Information
cationic amino acid transporter 2
UniProt Protein Name
Cationic amino acid transporter 2
UniProt Gene Name
SLC7A2
UniProt Synonym Gene Names
ATRC2; CAT2; CAT-2; CAT2
UniProt Entry Name
CTR2_HUMAN

NCBI Description

The protein encoded by this gene is a cationic amino acid transporter and a member of the APC (amino acid-polyamine-organocation) family of transporters. The encoded membrane protein is responsible for the cellular uptake of arginine, lysine and ornithine. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

SLC7A2: Low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). Plays a regulatory role in classical or alternative activation of macrophages. Belongs to the amino acid-polyamine-organocation (APC) superfamily. Cationic amino acid transporter (CAT) (TC 2.A.3.3) family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Transporter; Transporter, SLC family; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 8p22

Cellular Component: membrane; integral to plasma membrane; plasma membrane

Molecular Function: high affinity arginine transmembrane transporter activity; high affinity lysine transmembrane transporter activity; basic amino acid transmembrane transporter activity

Biological Process: amino acid metabolic process; macrophage activation; transport; amino acid transport; regulation of macrophage activation; production of nitric oxide during acute inflammatory response; regulation of inflammatory response; ion transport; nitric oxide biosynthetic process; transmembrane transport

Research Articles on SLC7A2

Similar Products

Product Notes

The SLC7A2 slc7a2 (Catalog #AAA3207022) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC7A2 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC7A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC7A2 slc7a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VANWKISEEF LKNISASARE PPSENGTSIY GAGGFMPYGF TGTLAGAATC. It is sometimes possible for the material contained within the vial of "SLC7A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.