Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SLC5A10Sample Tissue: RPMI 8226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human SLC5A10 Polyclonal Antibody | anti-SLC5A10 antibody

SLC5A10 Antibody - N-terminal region

Gene Names
SLC5A10; SGLT5; SGLT-5
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SLC5A10; Polyclonal Antibody; SLC5A10 Antibody - N-terminal region; anti-SLC5A10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAANSTSDLHTPGTQLSVADIIVITVYFALNVAVGIWSSCRASRNTVNGY
Sequence Length
596
Applicable Applications for anti-SLC5A10 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC5A10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SLC5A10Sample Tissue: RPMI 8226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SLC5A10Sample Tissue: RPMI 8226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SLC5A10 antibody
This gene is a member of the sodium/glucose transporter family. Members of this family are sodium-dependent transporters and can be divided into two subfamilies based on sequence homology, one that co-transports sugars and the second that transports molecules such as ascorbate, choline, iodide, lipoate, monocaroboxylates, and pantothenate. The protein encoded by this gene has the highest affinity for mannose and has been reported to be most highly expressed in the kidney. This protein may function as a kidney-specific, sodium-dependent mannose and fructose co-transporter. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
Product Categories/Family for anti-SLC5A10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65 kDa
NCBI Official Full Name
sodium/glucose cotransporter 5 isoform 2
NCBI Official Synonym Full Names
solute carrier family 5 member 10
NCBI Official Symbol
SLC5A10
NCBI Official Synonym Symbols
SGLT5; SGLT-5
NCBI Protein Information
sodium/glucose cotransporter 5
UniProt Protein Name
Sodium/glucose cotransporter 5
UniProt Gene Name
SLC5A10
UniProt Synonym Gene Names
SGLT5; Na(+)/glucose cotransporter 5

NCBI Description

This gene is a member of the sodium/glucose transporter family. Members of this family are sodium-dependent transporters and can be divided into two subfamilies based on sequence homology, one that co-transports sugars and the second that transports molecules such as ascorbate, choline, iodide, lipoate, monocaroboxylates, and pantothenate. The protein encoded by this gene has the highest affinity for mannose and has been reported to be most highly expressed in the kidney. This protein may function as a kidney-specific, sodium-dependent mannose and fructose co-transporter. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2012]

Uniprot Description

High capacity transporter for mannose and fructose and, to a lesser extent, glucose, AMG, and galactose.

Research Articles on SLC5A10

Similar Products

Product Notes

The SLC5A10 slc5a10 (Catalog #AAA3220821) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC5A10 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC5A10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC5A10 slc5a10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAANSTSDLH TPGTQLSVAD IIVITVYFAL NVAVGIWSSC RASRNTVNGY. It is sometimes possible for the material contained within the vial of "SLC5A10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.