Western Blot (WB)
(Host: RabbitTarget Name: SLC24A5Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human SLC24A5 Polyclonal Antibody | anti-SLC24A5 antibody
SLC24A5 Antibody - N-terminal region
Gene Names
SLC24A5; JSX; OCA6; NCKX5; SHEP4
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SLC24A5; Polyclonal Antibody; SLC24A5 Antibody - N-terminal region; anti-SLC24A5 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PLSGTSLPQRLPRATGNSTQCVISPSSEFPEGFFTRQERRDGGIIIYFLI
Sequence Length
500
Applicable Applications for anti-SLC24A5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC24A5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SLC24A5Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SLC24A5Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SLC24A5 antibody
This gene is a member of the potassium-dependent sodium/calcium exchanger family and encodes an intracellular membrane protein with 2 large hydrophilic loops and 2 sets of multiple transmembrane-spanning segments. Sequence variation in this gene has been associated with differences in skin pigmentation.
Product Categories/Family for anti-SLC24A5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55 kDa
NCBI Official Full Name
sodium/potassium/calcium exchanger 5
NCBI Official Synonym Full Names
solute carrier family 24 member 5
NCBI Official Symbol
SLC24A5
NCBI Official Synonym Symbols
JSX; OCA6; NCKX5; SHEP4
NCBI Protein Information
sodium/potassium/calcium exchanger 5
UniProt Protein Name
Sodium/potassium/calcium exchanger 5
Protein Family
UniProt Gene Name
SLC24A5
UniProt Synonym Gene Names
JSX; NCKX5
UniProt Entry Name
NCKX5_HUMAN
NCBI Description
This gene is a member of the potassium-dependent sodium/calcium exchanger family and encodes an intracellular membrane protein with 2 large hydrophilic loops and 2 sets of multiple transmembrane-spanning segments. Sequence variation in this gene has been associated with differences in skin pigmentation. [provided by RefSeq, Jul 2008]
Research Articles on SLC24A5
Similar Products
Product Notes
The SLC24A5 slc24a5 (Catalog #AAA3221392) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC24A5 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC24A5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC24A5 slc24a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PLSGTSLPQR LPRATGNSTQ CVISPSSEFP EGFFTRQERR DGGIIIYFLI. It is sometimes possible for the material contained within the vial of "SLC24A5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
