Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (NSUN5C antibody (MBS5301990) used at 2.5 ug/ml to detect target protein.)

Rabbit NSUN5C Polyclonal Antibody | anti-NSUN5C antibody

NSUN5C antibody

Gene Names
NSUN5P2; NOL1R2; NSUN5C; WBSCR20B; WBSCR20C
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
NSUN5C; Polyclonal Antibody; NSUN5C antibody; Polyclonal NSUN5C; Anti-NSUN5C; WBSCR20B; MGC129801; FLJ11626; DKFZp434K058; Nol1/Nop2/Sun Domain Family Member 5C; NSUNC 5; MGC15057; NOL1R2; WBSCR20C; NSUNC-5; DKFZp666P104; anti-NSUN5C antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
NSUN5C antibody was raised against the middle region of NSUN5C
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NSUN5C antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
53
Applicable Applications for anti-NSUN5C antibody
Western Blot (WB)
Application Notes
WB: 2.5 ug/ml
Biological Significance
NSUN5C gene shares high sequence similarity with several genes in the Williams Beuren Syndrome critical region and its deletion is associated with this disorder.
Cross-Reactivity
Human
Immunogen
NSUN5C antibody was raised using the middle region of NSUN5C corresponding to a region with amino acids PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(NSUN5C antibody (MBS5301990) used at 2.5 ug/ml to detect target protein.)

Western Blot (WB) (NSUN5C antibody (MBS5301990) used at 2.5 ug/ml to detect target protein.)
Related Product Information for anti-NSUN5C antibody
Rabbit polyclonal NSUN5C antibody raised against the middle region of NSUN5C
Product Categories/Family for anti-NSUN5C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
34 kDa (MW of target protein)
NCBI Official Full Name
NSUN5C protein
NCBI Official Synonym Full Names
NOP2/Sun domain family, member 5 pseudogene 2
NCBI Official Symbol
NSUN5P2
NCBI Official Synonym Symbols
NOL1R2; NSUN5C; WBSCR20B; WBSCR20C
UniProt Protein Name
Putative methyltransferase NSUN5C
UniProt Gene Name
NSUN5P2
UniProt Synonym Gene Names
NSUN5C; WBSCR20B; WBSCR20C
UniProt Entry Name
NSN5C_HUMAN

NCBI Description

This locus represents a transcribed pseudogene of a nearby locus on chromosome 7, which encodes a putative methyltransferase. There is also a third closely related pseudogene locus in this region. There is extensive alternative splicing at this locus. [provided by RefSeq, Jul 2013]

Uniprot Description

NSUN5C: May have S-adenosyl-L-methionine-dependent methyl- transferase activity. NSUN5C is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Belongs to the methyltransferase superfamily. RsmB/NOP family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.1.1.-; Methyltransferase

Chromosomal Location of Human Ortholog: 7q11.23

Molecular Function: methyltransferase activity; RNA binding

Biological Process: methylation

Similar Products

Product Notes

The NSUN5C nsun5p2 (Catalog #AAA5301990) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NSUN5C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 2.5 ug/ml. Researchers should empirically determine the suitability of the NSUN5C nsun5p2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NSUN5C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.