Western Blot (WB)
(SLC35F2 antibody (MBS5301588) used at 2.5 ug/ml to detect target protein.)
Rabbit SLC35F2 Polyclonal Antibody | anti-SLC35F2 antibody
SLC35F2 antibody
Gene Names
SLC35F2; HSNOV1
Applications
Western Blot, Immunohistochemistry
Purity
Total IgG Protein A purified
Synonyms
SLC35F2; Polyclonal Antibody; SLC35F2 antibody; Polyclonal SLC35F2; Anti-SLC35F2; FLJ13018; HSNOV1; DKFZp667H1615; SLCF2-35; SLCF2 35; Solute Carrier Family 35 Member F2; anti-SLC35F2 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
SLC35F2 antibody was raised against the N terminal of SLC35F2
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC35F2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
374
Applicable Applications for anti-SLC35F2 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 2.5 ug/ml
IHC: 4-8 ug/ml
IHC: 4-8 ug/ml
Biological Significance
SLC35F2 is a putative solute transporter.
Cross-Reactivity
Human
Immunogen
SLC35F2 antibody was raised using the N terminal of SLC35F2 corresponding to a region with amino acids MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLS
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(SLC35F2 antibody (MBS5301588) used at 2.5 ug/ml to detect target protein.)
Western Blot (WB)
(SLC35F2 antibody (MBS5301588) used at 2.5 ug/ml to detect target protein.)
Immunohistochemistry (IHC)
(SLC35F2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X)
Immunohistochemistry (IHC)
(SLC35F2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X)
Related Product Information for anti-SLC35F2 antibody
Rabbit polyclonal SLC35F2 antibody raised against the N terminal of SLC35F2
Product Categories/Family for anti-SLC35F2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41 kDa (MW of target protein)
NCBI Official Full Name
solute carrier family 35 member F2
NCBI Official Synonym Full Names
solute carrier family 35, member F2
NCBI Official Symbol
SLC35F2
NCBI Official Synonym Symbols
HSNOV1
NCBI Protein Information
solute carrier family 35 member F2
UniProt Protein Name
Solute carrier family 35 member F2
Protein Family
UniProt Gene Name
SLC35F2
UniProt Entry Name
S35F2_HUMAN
Uniprot Description
SLC35F2: Putative solute transporter (Potential). Belongs to the SLC35F solute transporter family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter, SLC family; Transporter
Chromosomal Location of Human Ortholog: 11q22.3
Cellular Component: integral to membrane
Biological Process: transport
Research Articles on SLC35F2
Similar Products
Product Notes
The SLC35F2 slc35f2 (Catalog #AAA5301588) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SLC35F2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 2.5 ug/ml IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the SLC35F2 slc35f2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC35F2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
