Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney )

Rabbit SLC38A1 Polyclonal Antibody | anti-SLC38A1 antibody

SLC38A1 antibody - middle region

Gene Names
SLC38A1; ATA1; NAT2; SAT1; SNAT1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
SLC38A1; Polyclonal Antibody; SLC38A1 antibody - middle region; anti-SLC38A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTN
Sequence Length
487
Applicable Applications for anti-SLC38A1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 85%; Dog: 91%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC38A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Western Blot (WB)

(WB Suggested Anti-SLC38A1 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysateSLC38A1 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-SLC38A1 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysateSLC38A1 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-SLC38A1 antibody
This is a rabbit polyclonal antibody against SLC38A1. It was validated on Western Blot and immunohistochemistry

Target Description: Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate.
Product Categories/Family for anti-SLC38A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
sodium-coupled neutral amino acid transporter 1 isoform 1
NCBI Official Synonym Full Names
solute carrier family 38 member 1
NCBI Official Symbol
SLC38A1
NCBI Official Synonym Symbols
ATA1; NAT2; SAT1; SNAT1
NCBI Protein Information
sodium-coupled neutral amino acid transporter 1
UniProt Protein Name
Sodium-coupled neutral amino acid transporter 1
UniProt Gene Name
SLC38A1
UniProt Synonym Gene Names
ATA1; NAT2; SAT1; SNAT1
UniProt Entry Name
S38A1_HUMAN

NCBI Description

Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate (Gu et al., 2001 [PubMed 11325958]).[supplied by OMIM, Mar 2008]

Uniprot Description

SLC38A1: Functions as a sodium-dependent amino acid transporter. Mediates the saturable, pH-sensitive and electrogenic cotransport of glutamine and sodium ions with a stoichiometry of 1:1. May also transport small zwitterionic and aliphatic amino acids with a lower affinity. May supply glutamatergic and GABAergic neurons with glutamine which is required for the synthesis of the neurotransmitters glutamate and GABA. Belongs to the amino acid/polyamine transporter 2 family.

Protein type: Transporter, SLC family; Transporter; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q13.11

Cellular Component: integral to plasma membrane; plasma membrane; integral to membrane

Molecular Function: neutral amino acid transmembrane transporter activity; sodium:amino acid symporter activity

Biological Process: neutral amino acid transport; synaptic transmission; amino acid transport; sodium ion transport; neurotransmitter uptake; ion transport; transmembrane transport

Research Articles on SLC38A1

Similar Products

Product Notes

The SLC38A1 slc38a1 (Catalog #AAA3207039) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC38A1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC38A1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SLC38A1 slc38a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLKNLGYLGY TSGFSLSCMV FFLIVVIYKK FQIPCIVPEL NSTISANSTN. It is sometimes possible for the material contained within the vial of "SLC38A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.