Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SLC30A9 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit SLC30A9 Polyclonal Antibody | anti-SLC30A9 antibody

SLC30A9 antibody - N-terminal region

Gene Names
SLC30A9; HUEL; ZNT9; GAC63; C4orf1; BILAPES
Reactivity
Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC30A9; Polyclonal Antibody; SLC30A9 antibody - N-terminal region; anti-SLC30A9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSQVKLYSTNVQKEGQGSQTLRVEKVPSFETAEGIGTELKAPLKQEPLQV
Sequence Length
568
Applicable Applications for anti-SLC30A9 antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Rabbit: 79%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC30A9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SLC30A9 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-SLC30A9 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-SLC30A9 antibody
This is a rabbit polyclonal antibody against SLC30A9. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HUEL includes the putative nuclear receptor interaction motif, nuclear localization and export signals, zinc finger, leucine zipper and acidic domains. HUEL is likely to be an evolutionarily conserved, housekeeping gene that plays a role intimately linked with cellular replication, DNA synthesis and/or transcriptional regulation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
zinc transporter 9
NCBI Official Synonym Full Names
solute carrier family 30 member 9
NCBI Official Symbol
SLC30A9
NCBI Official Synonym Symbols
HUEL; ZNT9; GAC63; C4orf1; BILAPES
NCBI Protein Information
zinc transporter 9
UniProt Protein Name
Zinc transporter 9
Protein Family
UniProt Gene Name
SLC30A9
UniProt Synonym Gene Names
C4orf1; HUEL; ZnT-9; HuEL
UniProt Entry Name
ZNT9_HUMAN

Uniprot Description

SLC30A9: Plays a role in the p160 coactivator signaling pathway that mediates transcriptional activation by nuclear receptors. Plays a role in transcriptional activation of Wnt- responsive genes. Belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family. SLC30A subfamily.

Protein type: Nuclear receptor co-regulator; Membrane protein, multi-pass; Transporter; Transporter, SLC family; Motility/polarity/chemotaxis; Cytoskeletal; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4p13

Cellular Component: cytoskeleton; integral to membrane; nucleus

Molecular Function: ligand-dependent nuclear receptor binding; ligand-dependent nuclear receptor transcription coactivator activity; cation transmembrane transporter activity; chromatin binding; transcription factor activity

Biological Process: transcription, DNA-dependent; nucleotide-excision repair; positive regulation of transcription from RNA polymerase II promoter; zinc ion transport

Research Articles on SLC30A9

Similar Products

Product Notes

The SLC30A9 slc30a9 (Catalog #AAA3201150) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC30A9 antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC30A9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC30A9 slc30a9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSQVKLYSTN VQKEGQGSQT LRVEKVPSFE TAEGIGTELK APLKQEPLQV. It is sometimes possible for the material contained within the vial of "SLC30A9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.