Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-EGR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysate)

Rabbit EGR1 Polyclonal Antibody | anti-EGR1 antibody

EGR1 antibody - middle region

Gene Names
EGR1; TIS8; AT225; G0S30; NGFI-A; ZNF225; KROX-24; ZIF-268
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EGR1; Polyclonal Antibody; EGR1 antibody - middle region; anti-EGR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS
Sequence Length
543
Applicable Applications for anti-EGR1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EGR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-EGR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysate)

Western Blot (WB) (WB Suggested Anti-EGR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysate)
Related Product Information for anti-EGR1 antibody
This is a rabbit polyclonal antibody against EGR1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a tr

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
early growth response protein 1
NCBI Official Synonym Full Names
early growth response 1
NCBI Official Symbol
EGR1
NCBI Official Synonym Symbols
TIS8; AT225; G0S30; NGFI-A; ZNF225; KROX-24; ZIF-268
NCBI Protein Information
early growth response protein 1
UniProt Protein Name
Early growth response protein 1
UniProt Gene Name
EGR1
UniProt Synonym Gene Names
KROX24; ZNF225; EGR-1; NGFI-A
UniProt Entry Name
EGR1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppressor gene. [provided by RefSeq, Dec 2014]

Uniprot Description

EGR1: Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'(EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation. By growth factors. Belongs to the EGR C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: histone acetyltransferase binding; protein binding; DNA binding; sequence-specific DNA binding; metal ion binding; double-stranded DNA binding; transcription factor binding; transcription factor activity

Biological Process: circadian rhythm; transcription from RNA polymerase II promoter; regulation of long-term neuronal synaptic plasticity; response to nutrient levels; cytokine and chemokine mediated signaling pathway; positive regulation of transcription, DNA-dependent; response to amphetamine; negative regulation of transcription from RNA polymerase II promoter; response to cocaine; BMP signaling pathway; learning and/or memory; response to ethanol; cellular response to insulin stimulus; positive regulation of neuron apoptosis; response to glucose stimulus; oligodendrocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; response to electrical stimulus; regulation of protein sumoylation; negative regulation of apoptosis; T cell differentiation

Research Articles on EGR1

Similar Products

Product Notes

The EGR1 egr1 (Catalog #AAA3213863) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EGR1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's EGR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EGR1 egr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSPVPTSFSS PGSSTYPSPV HSGFPSPSVA TTYSSVPPAF PAQVSSFPSS. It is sometimes possible for the material contained within the vial of "EGR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.