Western Blot (WB)
(WB Suggested Anti-ZNF331 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Rabbit anti-Human ZNF331 Polyclonal Antibody | anti-ZNF331 antibody
ZNF331 antibody - N-terminal region
Gene Names
ZNF331; RITA; ZNF361; ZNF463
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF331; Polyclonal Antibody; ZNF331 antibody - N-terminal region; anti-ZNF331 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YENKSLPTEKNIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYV
Sequence Length
463
Applicable Applications for anti-ZNF331 antibody
Western Blot (WB)
Homology
Human: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF331
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ZNF331 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Western Blot (WB)
(WB Suggested Anti-ZNF331 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Related Product Information for anti-ZNF331 antibody
This is a rabbit polyclonal antibody against ZNF331. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ZNF331 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZNF331 may be involved in transcriptional regulation. It may play a role in spermatogenesis. Zinc finger proteins have been shown to interact with nucleic acids and to have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form one family of zinc finger proteins. See ZFP93 (MIM 604749) for additional information on zinc finger proteins.[supplied by OMIM].
Target Description: ZNF331 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZNF331 may be involved in transcriptional regulation. It may play a role in spermatogenesis. Zinc finger proteins have been shown to interact with nucleic acids and to have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form one family of zinc finger proteins. See ZFP93 (MIM 604749) for additional information on zinc finger proteins.[supplied by OMIM].
Product Categories/Family for anti-ZNF331 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
zinc finger protein 331
NCBI Official Synonym Full Names
zinc finger protein 331
NCBI Official Symbol
ZNF331
NCBI Official Synonym Symbols
RITA; ZNF361; ZNF463
NCBI Protein Information
zinc finger protein 331
UniProt Protein Name
Zinc finger protein 331
Protein Family
UniProt Gene Name
ZNF331
UniProt Synonym Gene Names
RITA; ZNF361; ZNF463
UniProt Entry Name
ZN331_HUMAN
NCBI Description
This gene encodes a zinc finger protein containing a KRAB (Kruppel-associated box) domain found in transcriptional repressors. This gene may be methylated and silenced in cancer cells. This gene is located within a differentially methylated region (DMR) and shows allele-specific expression in placenta. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding the same protein. [provided by RefSeq, Nov 2015]
Research Articles on ZNF331
Similar Products
Product Notes
The ZNF331 znf331 (Catalog #AAA3202858) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF331 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF331 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF331 znf331 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YENKSLPTEK NIHEIRASKR NSDRRSKSLG RNWICEGTLE RPQRSRGRYV. It is sometimes possible for the material contained within the vial of "ZNF331, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
