Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry with Placenta tissue at an antibody concentration of 5ug/ml using anti-SLC26A4 antibody )

Rabbit SLC26A4 Polyclonal Antibody | anti-SLC26A4 antibody

SLC26A4 antibody - middle region

Gene Names
SLC26A4; EVA; PDS; DFNB4; TDH2B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SLC26A4; Polyclonal Antibody; SLC26A4 antibody - middle region; anti-SLC26A4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL
Sequence Length
780
Applicable Applications for anti-SLC26A4 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC26A4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with Placenta tissue at an antibody concentration of 5ug/ml using anti-SLC26A4 antibody )

Immunohistochemistry (IHC) (Immunohistochemistry with Placenta tissue at an antibody concentration of 5ug/ml using anti-SLC26A4 antibody )

Western Blot (WB)

(Host: RabbitTarget Name: SLC26A4Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SLC26A4Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: SLC26A4Sample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SLC26A4Sample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-SLC26A4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysate)

Western Blot (WB) (WB Suggested Anti-SLC26A4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysate)
Related Product Information for anti-SLC26A4 antibody
This is a rabbit polyclonal antibody against SLC26A4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3' of the S

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
pendrin
NCBI Official Synonym Full Names
solute carrier family 26 member 4
NCBI Official Symbol
SLC26A4
NCBI Official Synonym Symbols
EVA; PDS; DFNB4; TDH2B
NCBI Protein Information
pendrin
UniProt Protein Name
Pendrin
Protein Family
UniProt Gene Name
SLC26A4
UniProt Synonym Gene Names
PDS

NCBI Description

Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3' of the SLC26A3 gene. The encoded protein has homology to sulfate transporters. [provided by RefSeq, Jul 2008]

Uniprot Description

Sodium-independent transporter of chloride and iodide.

Research Articles on SLC26A4

Similar Products

Product Notes

The SLC26A4 slc26a4 (Catalog #AAA3206008) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC26A4 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC26A4 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SLC26A4 slc26a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELNDRFRHKI PVPIPIEVIV TIIATAISYG ANLEKNYNAG IVKSIPRGFL. It is sometimes possible for the material contained within the vial of "SLC26A4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.