Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SEMG1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysateSEMG1 is supported by BioGPS gene expression data to be expressed in COLO205)

Rabbit anti-Human, Pig SEMG1 Polyclonal Antibody | anti-SEMG1 antibody

SEMG1 antibody - middle region

Gene Names
SEMG1; SGI; SEMG; CT103; dJ172H20.2
Reactivity
Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SEMG1; Polyclonal Antibody; SEMG1 antibody - middle region; anti-SEMG1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHY
Sequence Length
402
Applicable Applications for anti-SEMG1 antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SEMG1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SEMG1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysateSEMG1 is supported by BioGPS gene expression data to be expressed in COLO205)

Western Blot (WB) (WB Suggested Anti-SEMG1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysateSEMG1 is supported by BioGPS gene expression data to be expressed in COLO205)
Related Product Information for anti-SEMG1 antibody
This is a rabbit polyclonal antibody against SEMG1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly
Product Categories/Family for anti-SEMG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Synonym Full Names
semenogelin 1
NCBI Official Symbol
SEMG1
NCBI Official Synonym Symbols
SGI; SEMG; CT103; dJ172H20.2
NCBI Protein Information
semenogelin-1
UniProt Protein Name
Semenogelin-1
Protein Family
UniProt Gene Name
SEMG1
UniProt Synonym Gene Names
SEMG; SGI
UniProt Entry Name
SEMG1_HUMAN

NCBI Description

The protein encoded by this gene is the predominant protein in semen. The encoded secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. This preproprotein is proteolytically processed by the prostate-specific antigen (PSA) protease to generate multiple peptide products that exhibit distinct functions. One of these peptides, SgI-29, is an antimicrobial peptide with antibacterial activity. This proteolysis process also breaks down the gel matrix and allows the spermatozoa to move more freely. This gene and another similar semenogelin gene are present in a gene cluster on chromosome 20. [provided by RefSeq, Feb 2016]

Uniprot Description

SEMG1: Predominant protein in semen. It participates in the formation of a gel matrix entrapping the accessory gland secretions and ejaculated spermatozoa. Fragments of semenogelin and/or fragments of the related proteins may contribute to the activation of progressive sperm movements as the gel-forming proteins are fragmented by KLK3/PSA. Belongs to the semenogelin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide; Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: 20q12-q13.2

Cellular Component: extracellular space; extracellular region; nucleus; secretory granule

Molecular Function: protein binding; structural molecule activity

Biological Process: insemination

Research Articles on SEMG1

Similar Products

Product Notes

The SEMG1 semg1 (Catalog #AAA3206188) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SEMG1 antibody - middle region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's SEMG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SEMG1 semg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KDIFSTQDEL LVYNKNQHQT KNLNQDQQHG RKANKISYQS SSTEERRLHY. It is sometimes possible for the material contained within the vial of "SEMG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.