Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-KRT16 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Rabbit KRT16 Polyclonal Antibody | anti-KRT16 antibody

KRT16 antibody - middle region

Gene Names
KRT16; K16; PC1; CK16; K1CP; NEPPK; FNEPPK; KRT16A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KRT16; Polyclonal Antibody; KRT16 antibody - middle region; anti-KRT16 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IAATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLD
Sequence Length
473
Applicable Applications for anti-KRT16 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KRT16
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-KRT16 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-KRT16 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Related Product Information for anti-KRT16 antibody
This is a rabbit polyclonal antibody against KRT16. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: KRT16 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles.The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles. Mutations in this gene are associated with type 1 pachyonychia congenita, non-epidermolytic palmoplantar keratoderma and unilateral palmoplantar verrucous nevus. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-KRT16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
keratin, type I cytoskeletal 16
NCBI Official Synonym Full Names
keratin 16
NCBI Official Symbol
KRT16
NCBI Official Synonym Symbols
K16; PC1; CK16; K1CP; NEPPK; FNEPPK; KRT16A
NCBI Protein Information
keratin, type I cytoskeletal 16
UniProt Protein Name
Keratin, type I cytoskeletal 16
Protein Family
UniProt Gene Name
KRT16
UniProt Synonym Gene Names
KRT16A; CK-16; K16
UniProt Entry Name
K1C16_HUMAN

NCBI Description

The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles. Mutations in this gene are associated with type 1 pachyonychia congenita, non-epidermolytic palmoplantar keratoderma and unilateral palmoplantar verrucous nevus. [provided by RefSeq, Jul 2008]

Uniprot Description

K16: a type I cytoskeletal keratin. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. There are two types of cytoskeletal and microfibrillar keratin: type I (acidic; 40-55 kDa) [K9 to K20] and type II (neutral to basic; 56-70 kDa) [K1 to K8]. Both a basic and an acidic keratin are required for filament assembly. Generally associates with K6. K16 and K17 are coexpressed only in pathological situations such as metaplasias and carcinomas of the uterine cervix and in psoriasis vulgaris.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 17q21.2

Cellular Component: cytoskeleton; intermediate filament; nucleus

Molecular Function: protein binding; structural constituent of cytoskeleton

Biological Process: epidermis development; intermediate filament cytoskeleton organization and biogenesis; cytoskeleton organization and biogenesis; keratinocyte migration; hair cycle; keratinocyte differentiation; cell proliferation; keratinization; morphogenesis of an epithelium; innate immune response; inflammatory response; negative regulation of cell migration; aging

Disease: Palmoplantar Keratoderma, Nonepidermolytic, Focal; Pachyonychia Congenita 1

Research Articles on KRT16

Similar Products

Product Notes

The KRT16 krt16 (Catalog #AAA3206265) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KRT16 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's KRT16 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KRT16 krt16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IAATIENAQP ILQIDNARLA ADDFRTKYEH ELALRQTVEA DVNGLRRVLD. It is sometimes possible for the material contained within the vial of "KRT16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.