Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SLC22A5 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellSLC22A5 is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit SLC22A5 Polyclonal Antibody | anti-SLC22A5 antibody

SLC22A5 Antibody - C-terminal region

Gene Names
SLC22A5; CDSP; OCTN2
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC22A5; Polyclonal Antibody; SLC22A5 Antibody - C-terminal region; anti-SLC22A5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TLFLPESFGTPLPDTIDQMLRVKGMKHRKTPSHTRMLKDGQERPTILKST
Sequence Length
557
Applicable Applications for anti-SLC22A5 antibody
Western Blot (WB)
Homology
Cow: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 77%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of SLC22A5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SLC22A5 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellSLC22A5 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (WB Suggested Anti-SLC22A5 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellSLC22A5 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-SLC22A5 antibody
This is a rabbit polyclonal antibody against SLC22A5. It was validated on Western Blot

Target Description: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is a plasma integral membrane protein which functions both as an organic cation transporter and as a sodium-dependent high affinity carnitine transporter. The encoded protein is involved in the active cellular uptake of carnitine. Mutations in this gene are the cause of systemic primary carnitine deficiency (CDSP), an autosomal recessive disorder manifested early in life by hypoketotic hypoglycemia and acute metabolic decompensation, and later in life by skeletal myopathy or cardiomyopathy.
Product Categories/Family for anti-SLC22A5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
solute carrier family 22 member 5 isoform b
NCBI Official Synonym Full Names
solute carrier family 22 member 5
NCBI Official Symbol
SLC22A5
NCBI Official Synonym Symbols
CDSP; OCTN2
NCBI Protein Information
solute carrier family 22 member 5
UniProt Protein Name
Solute carrier family 22 member 5
Protein Family
UniProt Gene Name
SLC22A5
UniProt Synonym Gene Names
OCTN2
UniProt Entry Name
S22A5_HUMAN

NCBI Description

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is a plasma integral membrane protein which functions both as an organic cation transporter and as a sodium-dependent high affinity carnitine transporter. The encoded protein is involved in the active cellular uptake of carnitine. Mutations in this gene are the cause of systemic primary carnitine deficiency (CDSP), an autosomal recessive disorder manifested early in life by hypoketotic hypoglycemia and acute metabolic decompensation, and later in life by skeletal myopathy or cardiomyopathy. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2015]

Uniprot Description

SLC22A5: Sodium-ion dependent, high affinity carnitine transporter. Involved in the active cellular uptake of carnitine. Transports one sodium ion with one molecule of carnitine. Also transports organic cations such as tetraethylammonium (TEA) without the involvement of sodium. Also relative uptake activity ratio of carnitine to TEA is 11.3. Defects in SLC22A5 are the cause of systemic primary carnitine deficiency (CDSP). CDSP is an autosomal recessive disorder of fatty acid oxidation caused by defective carnitine transport. Present early in life with hypoketotic hypoglycemia and acute metabolic decompensation, or later in life with skeletal myopathy or cardiomyopathy. Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, SLC family; Membrane protein, integral; Membrane protein, multi-pass; Transporter

Chromosomal Location of Human Ortholog: 5q23.3

Cellular Component: basolateral plasma membrane; brush border membrane; apical plasma membrane; integral to membrane; plasma membrane

Molecular Function: protein binding; antibiotic transporter activity; symporter activity; carnitine transporter activity; drug transporter activity; quaternary ammonium group transmembrane transporter activity; ATP binding; PDZ domain binding

Biological Process: quaternary ammonium group transport; drug transport; antibiotic transport; sodium ion transport; multidrug transport; transmembrane transport; carnitine transport; quorum sensing during interaction with host

Disease: Carnitine Deficiency, Systemic Primary

Research Articles on SLC22A5

Similar Products

Product Notes

The SLC22A5 slc22a5 (Catalog #AAA3216009) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC22A5 Antibody - C-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC22A5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC22A5 slc22a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TLFLPESFGT PLPDTIDQML RVKGMKHRKT PSHTRMLKDG QERPTILKST. It is sometimes possible for the material contained within the vial of "SLC22A5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.