Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of SLC18A3 expression in HELA whole cell lysates (lane 1) and HEPA whole cell lysates (lane 2). SLC18A3 at 55KD was detected using rabbit anti- SLC18A3 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit anti-Human, Mouse SLC18A3 Polyclonal Antibody | anti-SLC18A3 antibody

Anti-SLC18A3 Antibody

Gene Names
SLC18A3; CMS21; VACHT
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
SLC18A3; Polyclonal Antibody; Anti-SLC18A3 Antibody; AChR; Rvat; Slc18a3; VAChT; Q16572; Vesicular acetylcholine transporter; solute carrier family 18 member A3; anti-SLC18A3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
532
Applicable Applications for anti-SLC18A3 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human SLC18A3 (1-36aa MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVL), different from the related mouse and rat sequences by five amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of SLC18A3 expression in HELA whole cell lysates (lane 1) and HEPA whole cell lysates (lane 2). SLC18A3 at 55KD was detected using rabbit anti- SLC18A3 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of SLC18A3 expression in HELA whole cell lysates (lane 1) and HEPA whole cell lysates (lane 2). SLC18A3 at 55KD was detected using rabbit anti- SLC18A3 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-SLC18A3 antibody
Rabbit IgG polyclonal antibody for Vesicular acetylcholine transporter(SLC18A3) detection.
Background: The Vesicular acetylcholine transporter (VAChT), also known as SLC18A3, is a neurotransmitter transporter which is responsible for loadingacetylcholine (ACh) into secretory organelles in neurons making acetylcholine available for secretion. It is encoded by Solute carrier family 18, member 3 (SLC18A3) gene. This gene is a member of the vesicular amine transporter family. The encoded transmembrane protein transports acetylcholine into secretory vesicles for release into the extracellular space. Acetylcholine transport utilizes a proton gradient established by a vacuolar ATPase. This gene is located within the first intron of the choline acetyltransferase gene.
References
1. Erickson JD, Varoqui H (Dec 2000). "Molecular analysis of vesicular amine transporter function and targeting to secretory organelles". FASEB Journal. 14 (15): 2450-8.
2. Weihe E, Tao-Cheng JH, Schäfer MK, Erickson JD, Eiden LE (Apr 1996). "Visualization of the vesicular acetylcholine transporter in cholinergic nerve terminals and its targeting to a specific population of small synaptic vesicles". Proceedings of the National Academy of Sciences of the United States of America. 93 (8): 3547-52.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56,903 Da
NCBI Official Full Name
vesicular acetylcholine transporter
NCBI Official Synonym Full Names
solute carrier family 18 member A3
NCBI Official Symbol
SLC18A3
NCBI Official Synonym Symbols
CMS21; VACHT
NCBI Protein Information
vesicular acetylcholine transporter
UniProt Protein Name
Vesicular acetylcholine transporter
UniProt Gene Name
SLC18A3
UniProt Synonym Gene Names
VACHT; VAChT

NCBI Description

This gene is a member of the vesicular amine transporter family. The encoded transmembrane protein transports acetylcholine into secretory vesicles for release into the extracellular space. Acetylcholine transport utilizes a proton gradient established by a vacuolar ATPase. This gene is located within the first intron of the choline acetyltransferase gene. [provided by RefSeq, Jul 2008]

Uniprot Description

SLC18A3: Involved in acetylcholine transport into synaptic vesicles. Belongs to the major facilitator superfamily. Vesicular transporter family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter; Transporter, SLC family

Chromosomal Location of Human Ortholog: 10q11.23

Cellular Component: AP-1 adaptor complex; AP-2 adaptor complex; integral to plasma membrane; membrane; plasma membrane; synaptic vesicle membrane; terminal button

Molecular Function: acetylcholine binding; acetylcholine transmembrane transporter activity; monoamine transmembrane transporter activity

Biological Process: acetylcholine transport; neurotransmitter secretion; synaptic transmission

Disease: Myasthenic Syndrome, Congenital, 21, Presynaptic

Research Articles on SLC18A3

Similar Products

Product Notes

The SLC18A3 slc18a3 (Catalog #AAA178692) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-SLC18A3 Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SLC18A3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the SLC18A3 slc18a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC18A3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.