Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SLC18A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Rabbit SLC18A1 Polyclonal Antibody | anti-SLC18A1 antibody

SLC18A1 antibody - N-terminal region

Gene Names
SLC18A1; CGAT; VAT1; VMAT1
Reactivity
Guinea Pig, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC18A1; Polyclonal Antibody; SLC18A1 antibody - N-terminal region; anti-SLC18A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITRVGVLFASKAVMQLL
Sequence Length
525
Applicable Applications for anti-SLC18A1 antibody
Western Blot (WB)
Homology
Guinea Pig: 79%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC18A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SLC18A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-SLC18A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-SLC18A1 antibody
This is a rabbit polyclonal antibody against SLC18A1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SLC18A1 is an integral protein in the membrane of secretory vesicles of neuroendocrine and endocrine cells that allows the transport of biogenic monoamines, such as serotonin, from the cytoplasm into the secretory vesicles.
Product Categories/Family for anti-SLC18A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
chromaffin granule amine transporter isoform a
NCBI Official Synonym Full Names
solute carrier family 18 member A1
NCBI Official Symbol
SLC18A1
NCBI Official Synonym Symbols
CGAT; VAT1; VMAT1
NCBI Protein Information
chromaffin granule amine transporter
UniProt Protein Name
Chromaffin granule amine transporter
UniProt Gene Name
SLC18A1
UniProt Synonym Gene Names
VAT1; VMAT1; VAT1
UniProt Entry Name
VMAT1_HUMAN

NCBI Description

The vesicular monoamine transporter acts to accumulate cytosolic monoamines into vesicles, using the proton gradient maintained across the vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine (Peter et al., 1993 [PubMed 7905859]). See also SLC18A2 (MIM 193001).[supplied by OMIM, Mar 2008]

Uniprot Description

SLC18A1: Involved in the vesicular transport of biogenic amines. Belongs to the major facilitator superfamily. Vesicular transporter family.

Protein type: Transporter, SLC family; Membrane protein, multi-pass; Membrane protein, integral; Transporter

Chromosomal Location of Human Ortholog: 8p21.3

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: monoamine transmembrane transporter activity; drug transporter activity

Biological Process: neurotransmitter transport; monoamine transport; multidrug transport; transmembrane transport

Research Articles on SLC18A1

Similar Products

Product Notes

The SLC18A1 slc18a1 (Catalog #AAA3202682) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC18A1 antibody - N-terminal region reacts with Guinea Pig, Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC18A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC18A1 slc18a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MNDTASTIPP PATEAISAHK NNCLQGTGFL EEEITRVGVL FASKAVMQLL. It is sometimes possible for the material contained within the vial of "SLC18A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.