Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SIRT5 rabbit polyclonal antibody. Western Blot analysis of SIRT5 expression in human kidney.)

Rabbit anti-Human Sirtuin 5 Polyclonal Antibody | anti-SIRT5 antibody

Sirtuin 5 (SIRT5, NAD-dependent Protein Deacylase Sirtuin-5, Mitochondrial, Regulatory Protein SIR2 Homolog 5, SIR2-like Protein 5, SIR2L5) (Biotin)

Gene Names
SIRT5; SIR2L5
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Sirtuin 5; Polyclonal Antibody; Sirtuin 5 (SIRT5; NAD-dependent Protein Deacylase Sirtuin-5; Mitochondrial; Regulatory Protein SIR2 Homolog 5; SIR2-like Protein 5; SIR2L5) (Biotin); EC=3.5.1.-; anti-SIRT5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SIRT5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1670
Applicable Applications for anti-SIRT5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SIRT5, aa1-310 (NP_036373.1).
Immunogen Sequence
MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SIRT5 rabbit polyclonal antibody. Western Blot analysis of SIRT5 expression in human kidney.)

Western Blot (WB) (SIRT5 rabbit polyclonal antibody. Western Blot analysis of SIRT5 expression in human kidney.)

Western Blot (WB)

(SIRT5 rabbit polyclonal antibody. Western Blot analysis of SIRT5 expression in HeLa.)

Western Blot (WB) (SIRT5 rabbit polyclonal antibody. Western Blot analysis of SIRT5 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of SIRT5 expression in transfected 293T cell line by SIRT5 polyclonal antibody. Lane 1: SIRT5 transfected lysate (33.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SIRT5 expression in transfected 293T cell line by SIRT5 polyclonal antibody. Lane 1: SIRT5 transfected lysate (33.9kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SIRT5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae) (SIRT5), transcript variant 1, mRNA
NCBI Official Synonym Full Names
sirtuin 5
NCBI Official Symbol
SIRT5
NCBI Official Synonym Symbols
SIR2L5
NCBI Protein Information
NAD-dependent protein deacylase sirtuin-5, mitochondrial

NCBI Description

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2010]

Research Articles on SIRT5

Similar Products

Product Notes

The SIRT5 (Catalog #AAA6394203) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Sirtuin 5 (SIRT5, NAD-dependent Protein Deacylase Sirtuin-5, Mitochondrial, Regulatory Protein SIR2 Homolog 5, SIR2-like Protein 5, SIR2L5) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Sirtuin 5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SIRT5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Sirtuin 5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.