Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SHROOM2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)

Rabbit SHROOM2 Polyclonal Antibody | anti-SHROOM2 antibody

SHROOM2 antibody - middle region

Gene Names
SHROOM2; APXL; HSAPXL
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SHROOM2; Polyclonal Antibody; SHROOM2 antibody - middle region; anti-SHROOM2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTM
Sequence Length
1616
Applicable Applications for anti-SHROOM2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SHROOM2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SHROOM2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-SHROOM2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Related Product Information for anti-SHROOM2 antibody
This is a rabbit polyclonal antibody against SHROOM2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SHROOM2 shares significant similarities with the apical protein from Xenopus laevis which is implicated in amiloride-sensitive sodium channel activity. This gene is a strong candidate gene for ocular albinism type 1 syndrome.The protein encoded by this gene shares significant similarities with the apical protein from Xenopus laevis which is implicated in amiloride-sensitive sodium channel activity. This gene is a strong candidate gene for ocular albinism type 1 syndrome.
Product Categories/Family for anti-SHROOM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
357
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
176kDa
NCBI Official Full Name
protein Shroom2 isoform 1
NCBI Official Synonym Full Names
shroom family member 2
NCBI Official Symbol
SHROOM2
NCBI Official Synonym Symbols
APXL; HSAPXL
NCBI Protein Information
protein Shroom2
UniProt Protein Name
Protein Shroom2
Protein Family
UniProt Gene Name
SHROOM2
UniProt Synonym Gene Names
APXL
UniProt Entry Name
SHRM2_HUMAN

NCBI Description

This gene represents the human homolog of Xenopus laevis apical protein (APX) gene, which is implicated in amiloride-sensitive sodium channel activity. It is expressed in endothelial cells and facilitates the formation of a contractile network within endothelial cells. Depletion of this gene results in an increase in endothelial sprouting, migration, and angiogenesis. This gene is highly expressed in the retina, and is a strong candidate for ocular albinism type 1 syndrome. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2016]

Uniprot Description

APXL: May be involved in endothelial cell morphology changes during cell spreading. In the retinal pigment epithelium, may regulate the biogenesis of melanosomes and promote their association with the apical cell surface by inducing gamma-tubulin redistribution. Belongs to the shroom family.

Protein type: Channel, sodium

Chromosomal Location of Human Ortholog: Xp22.3

Cellular Component: filamentous actin; microtubule; cortical actin cytoskeleton; tight junction; cell-cell adherens junction; cytoskeleton; cell soma; apical plasma membrane; plasma membrane

Molecular Function: actin filament binding; amiloride-sensitive sodium channel activity; protein domain specific binding; protein binding; beta-catenin binding; actin binding

Biological Process: eye pigment granule organization and biogenesis; actin filament bundle formation; cell migration; camera-type eye development; cell morphogenesis; negative regulation of actin filament depolymerization; ear development; cellular pigment accumulation; apical protein localization; camera-type eye morphogenesis; melanosome organization and biogenesis; establishment of melanosome localization; lens morphogenesis in camera-type eye; brain development; intercellular junction maintenance

Research Articles on SHROOM2

Similar Products

Product Notes

The SHROOM2 shroom2 (Catalog #AAA3202413) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SHROOM2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SHROOM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SHROOM2 shroom2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CTSPPGLSYM KAKEKTVEDL KSEELAREIV GKDKSLADIL DPSVKIKTTM. It is sometimes possible for the material contained within the vial of "SHROOM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.