Western Blot (WB)
(WB Suggested Anti-SHBG AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Rabbit SHBG Polyclonal Antibody | anti-SHBG antibody
SHBG Antibody - C-terminal region
Gene Names
SHBG; ABP; SBP; TEBG
Reactivity
Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SHBG; Polyclonal Antibody; SHBG Antibody - C-terminal region; anti-SHBG antibody
Host
Rabbit
Reactivity
Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH
Sequence Length
287
Applicable Applications for anti-SHBG antibody
Western Blot (WB)
Homology
Human: 100%; Rabbit: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of SHBG
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SHBG AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Western Blot (WB)
(WB Suggested Anti-SHBG AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Related Product Information for anti-SHBG antibody
This is a rabbit polyclonal antibody against SHBG. It was validated on Western Blot
Target Description: This gene encodes a steroid binding protein that was first described as a plasma protein secreted by the liver but is now thought to participate in the regulation of steroid responses. The encoded protein binds each steroid molecule as a dimer formed from identical or nearly identical monomers. The use of alternate promoters and alternatively spliced transcripts have been described. Multiple transcript variants encoding different isoforms have been found for this gene.
Target Description: This gene encodes a steroid binding protein that was first described as a plasma protein secreted by the liver but is now thought to participate in the regulation of steroid responses. The encoded protein binds each steroid molecule as a dimer formed from identical or nearly identical monomers. The use of alternate promoters and alternatively spliced transcripts have been described. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-SHBG antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31kDa
NCBI Official Full Name
sex hormone-binding globulin isoform 4
NCBI Official Synonym Full Names
sex hormone binding globulin
NCBI Official Symbol
SHBG
NCBI Official Synonym Symbols
ABP; SBP; TEBG
NCBI Protein Information
sex hormone-binding globulin
Protein Family
NCBI Description
This gene encodes a steroid binding protein that was first described as a plasma protein secreted by the liver but is now thought to participate in the regulation of steroid responses. The encoded protein transports androgens and estrogens in the blood, binding each steroid molecule as a dimer formed from identical or nearly identical monomers. Polymorphisms in this gene have been associated with polycystic ovary syndrome and type 2 diabetes mellitus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Research Articles on SHBG
Similar Products
Product Notes
The SHBG (Catalog #AAA3215837) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SHBG Antibody - C-terminal region reacts with Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's SHBG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SHBG for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RGEDSSTSFC LNGLWAQGQR LDVDQALNRS HEIWTHSCPQ SPGNGTDASH. It is sometimes possible for the material contained within the vial of "SHBG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
