Rabbit anti-Human SH2D1A Polyclonal Antibody | anti-SH2D1A antibody

SH2D1A (SH2 Domain-containing Protein 1A, Duncan Disease SH2-protein, Signaling Lymphocytic Activation Molecule-associated Protein, SLAM-associated Protein, T-cell Signal Transduction Molecule SAP, DSHP, SAP, FLJ18687, FLJ92177) (PE)

Cat. Num. AAA6394079

• Gene Names: SH2D1A; LYP; SAP; XLP; DSHP; EBVS; IMD5; XLPD; MTCP1; XLPD1; SAP/SH2D1A
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SH2D1A; Polyclonal Antibody; SH2D1A (SH2 Domain-containing Protein 1A; Duncan Disease SH2-protein; Signaling Lymphocytic Activation Molecule-associated Protein; SLAM-associated Protein; T-cell Signal Transduction Molecule SAP; DSHP; SAP; FLJ18687; FLJ92177) (PE); anti-SH2D1A antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SH2D1A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-SH2D1A antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human SH2D1A, aa1-128 (NP_002342.1).
• Immunogen Sequence: MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SH2D1A expression in transfected 293T cell line by SH2D1A polyclonal antibody. Lane 1: SH2D1A transfected lysate (14.08kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-SH2D1A antibody

Inhibitor of the SLAM self-association. Acts by blocking recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to a docking site in the SLAM cytoplasmic region. Mediates interaction between FYN and SLAMF1. May also regulate the activity of the neurotrophin receptors NTRK1, NTRK2 and NTRK3.

Product Categories/Family for anti-SH2D1A antibody

Antibodies; Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 4506923
• NCBI GeneID: 4068
• NCBI Accession #: NP_002342.1
• NCBI GenBank Nucleotide #: NM_002351
• UniProt Accession #: O60880
• NCBI Official Full Name: SH2 domain-containing protein 1A isoform 1
• NCBI Official Synonym Full Names: SH2 domain containing 1A
• NCBI Official Symbol: SH2D1A
• NCBI Official Synonym Symbols: LYP; SAP; XLP; DSHP; EBVS; IMD5; XLPD; MTCP1; XLPD1; SAP/SH2D1A
• NCBI Protein Information: SH2 domain-containing protein 1A
• UniProt Protein Name: SH2 domain-containing protein 1A
• Protein Family: SH2 domain-containing protein
• UniProt Gene Name: SH2D1A
• UniProt Synonym Gene Names: DSHP; SAP; SLAM-associated protein
• UniProt Entry Name: SH21A_HUMAN

NCBI Description

This gene encodes a protein that plays a major role in the bidirectional stimulation of T and B cells. This protein contains an SH2 domain and a short tail. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in this gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]