Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SH2D1A expression in transfected 293T cell line by SH2D1A polyclonal antibody. Lane 1: SH2D1A transfected lysate (14.08kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SH2D1A Polyclonal Antibody | anti-SH2D1A antibody

SH2D1A (SH2 Domain-containing Protein 1A, Duncan Disease SH2-protein, Signaling Lymphocytic Activation Molecule-associated Protein, SLAM-associated Protein, T-cell Signal Transduction Molecule SAP, DSHP, SAP, FLJ18687, FLJ92177) APC

Gene Names
SH2D1A; LYP; SAP; XLP; DSHP; EBVS; IMD5; XLPD; MTCP1; XLPD1; SAP/SH2D1A
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SH2D1A; Polyclonal Antibody; SH2D1A (SH2 Domain-containing Protein 1A; Duncan Disease SH2-protein; Signaling Lymphocytic Activation Molecule-associated Protein; SLAM-associated Protein; T-cell Signal Transduction Molecule SAP; DSHP; SAP; FLJ18687; FLJ92177) APC; anti-SH2D1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SH2D1A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SH2D1A antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SH2D1A, aa1-128 (NP_002342.1).
Immunogen Sequence
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SH2D1A expression in transfected 293T cell line by SH2D1A polyclonal antibody. Lane 1: SH2D1A transfected lysate (14.08kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SH2D1A expression in transfected 293T cell line by SH2D1A polyclonal antibody. Lane 1: SH2D1A transfected lysate (14.08kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SH2D1A antibody
Inhibitor of the SLAM self-association. Acts by blocking recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to a docking site in the SLAM cytoplasmic region. Mediates interaction between FYN and SLAMF1. May also regulate the activity of the neurotrophin receptors NTRK1, NTRK2 and NTRK3.
Product Categories/Family for anti-SH2D1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
SH2 domain-containing protein 1A isoform 1
NCBI Official Synonym Full Names
SH2 domain containing 1A
NCBI Official Symbol
SH2D1A
NCBI Official Synonym Symbols
LYP; SAP; XLP; DSHP; EBVS; IMD5; XLPD; MTCP1; XLPD1; SAP/SH2D1A
NCBI Protein Information
SH2 domain-containing protein 1A
UniProt Protein Name
SH2 domain-containing protein 1A
UniProt Gene Name
SH2D1A
UniProt Synonym Gene Names
DSHP; SAP; SLAM-associated protein
UniProt Entry Name
SH21A_HUMAN

NCBI Description

This gene encodes a protein that plays a major role in the bidirectional stimulation of T and B cells. This protein contains an SH2 domain and a short tail. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in this gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Research Articles on SH2D1A

Similar Products

Product Notes

The SH2D1A sh2d1a (Catalog #AAA6394070) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SH2D1A (SH2 Domain-containing Protein 1A, Duncan Disease SH2-protein, Signaling Lymphocytic Activation Molecule-associated Protein, SLAM-associated Protein, T-cell Signal Transduction Molecule SAP, DSHP, SAP, FLJ18687, FLJ92177) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SH2D1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SH2D1A sh2d1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SH2D1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.