Mouse anti-Human SH2D1A Monoclonal Antibody | anti-SH2D1A antibody

SH2D1A (SH2 Domain-containing Protein 1A, Duncan Disease SH2-protein, Signaling Lymphocytic Activation Molecule-associated Protein, SLAM-associated Protein, T-cell Signal Transduction Molecule SAP, DSHP, SAP, FLJ18687, FLJ92177) (AP)

Cat. Num. AAA6133723

• Gene Names: SH2D1A; LYP; SAP; XLP; DSHP; EBVS; IMD5; XLPD; MTCP1; XLPD1; SAP/SH2D1A
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SH2D1A; Monoclonal Antibody; SH2D1A (SH2 Domain-containing Protein 1A; Duncan Disease SH2-protein; Signaling Lymphocytic Activation Molecule-associated Protein; SLAM-associated Protein; T-cell Signal Transduction Molecule SAP; DSHP; SAP; FLJ18687; FLJ92177) (AP); anti-SH2D1A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1C9
• Specificity: Recognizes human SH2D1A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-SH2D1A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-128 from human SH2D1A (AAH20732) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (39.82kD).)

Western Blot (WB)

(SH2D1A monoclonal antibody Western Blot analysis of SH2D1A expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of SH2D1A expression in transfected 293T cell line by SH2D1A monoclonal antibody. Lane 1: SH2D1A transfected lysate (14.2kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-SH2D1A antibody

Inhibitor of the SLAM self-association. Acts by blocking recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to a docking site in the SLAM cytoplasmic region. Mediates interaction between FYN and SLAMF1. May also regulate the activity of the neurotrophin receptors NTRK1, NTRK2 and NTRK3.

Product Categories/Family for anti-SH2D1A antibody

Antibodies; Signal Transduction

References

1. Expansion of somatically reverted memory CD8+ T cells in patients with X-linked lymphoproliferative disease caused by selective pressure from Epstein-Barr virus. Palendira U, Low C, Bell AI, Ma CS, Abbott RJ, Phan TG, Riminton DS, Choo S, Smart JM, Lougaris V, Giliani S, Buckley RH, Grimbacher B, Alvaro F, Klion AD, Nichols KE, Adelstein S, Rickinson AB, Tangye SG.J Exp Med. 2012 Apr 9. 2. Molecular Pathogenesis of EBV Susceptibility in XLP as Revealed by Analysis of Female Carriers with Heterozygous Expression of SAP. Palendira U, Low C, Chan A, Hislop AD, Ho E, Phan TG, Deenick E, Cook MC, Riminton DS, Choo S, Loh R, Alvaro F, Booth C, Gaspar HB, Moretta A, Khanna R, Rickinson AB, Tangye SG.PLoS Biol. 2011 Nov;9(11):e1001187. Epub 2011 Nov 1. 3. Early commitment of naive human CD4(+) T cells to the T follicular helper (T(FH)) cell lineage is induced by IL-12. Ma CS, Suryani S, Avery DT, Chan A, Nanan R, Santner-Nanan B, Deenick EK, Tangye SG.Immunol Cell Biol. 2009 Sep 1.

NCBI and Uniprot Product Information

• NCBI GI #: 18088433
• NCBI GeneID: 4068
• Molecular Weight: 6,631 Da
• NCBI Official Full Name: Homo sapiens SH2 domain protein 1A, mRNA
• NCBI Official Synonym Full Names: SH2 domain containing 1A
• NCBI Official Symbol: SH2D1A
• NCBI Official Synonym Symbols: LYP; SAP; XLP; DSHP; EBVS; IMD5; XLPD; MTCP1; XLPD1; SAP/SH2D1A
• NCBI Protein Information: SH2 domain-containing protein 1A
• Protein Family: SH2 domain-containing protein

NCBI Description

This gene encodes a protein that plays a major role in the bidirectional stimulation of T and B cells. This protein contains an SH2 domain and a short tail. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in this gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]