Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SGTASample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SGTA Polyclonal Antibody | anti-SGTA antibody

SGTA Antibody - middle region

Gene Names
SGTA; SGT; hSGT; alphaSGT
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SGTA; Polyclonal Antibody; SGTA Antibody - middle region; anti-SGTA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIEL
Sequence Length
313
Applicable Applications for anti-SGTA antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SGTA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SGTASample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SGTASample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SGTA antibody
This gene encodes a protein which is capable of interacting with the major nonstructural protein of parvovirus H-1 and 70-kDa heat shock cognate protein; however, its function is not known. Since this transcript is expressed ubiquitously in various tissues, this protein may serve a housekeeping function.
Product Categories/Family for anti-SGTA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
small glutamine-rich tetratricopeptide repeat-containing protein alpha
NCBI Official Synonym Full Names
small glutamine rich tetratricopeptide repeat containing alpha
NCBI Official Symbol
SGTA
NCBI Official Synonym Symbols
SGT; hSGT; alphaSGT
NCBI Protein Information
small glutamine-rich tetratricopeptide repeat-containing protein alpha
UniProt Protein Name
Small glutamine-rich tetratricopeptide repeat-containing protein alpha
UniProt Gene Name
SGTA
UniProt Synonym Gene Names
SGT; SGT1; UBP
UniProt Entry Name
SGTA_HUMAN

NCBI Description

This gene encodes a protein which is capable of interacting with the major nonstructural protein of parvovirus H-1 and 70-kDa heat shock cognate protein; however, its function is not known. Since this transcript is expressed ubiquitously in various tissues, this protein may serve a housekeeping function. [provided by RefSeq, Jul 2008]

Uniprot Description

SGTA: Co-chaperone that binds directly to HSC70 and HSP70 and regulates their ATPase activity. Homooligomerize. Interacts with NS1 from parvovirus H-1, with Vpu and Gag from HIV-1. Interacts with SARS- CoV accessory protein 7a. Interacts with DNAJC5 and DNAJC5B. Ubiquitous. Belongs to the SGT family.

Protein type: Chaperone

Chromosomal Location of Human Ortholog: 19p13

Cellular Component: cytoplasm

Molecular Function: protein binding

Biological Process: viral reproduction

Research Articles on SGTA

Similar Products

Product Notes

The SGTA sgta (Catalog #AAA3222529) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SGTA Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SGTA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SGTA sgta for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MPQDLRSPAR TPPSEEDSAE AERLKTEGNE QMKVENFEAA VHFYGKAIEL. It is sometimes possible for the material contained within the vial of "SGTA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.