Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human SGCG Monoclonal Antibody | anti-SGCG antibody

SGCG (Gamma-sarcoglycan, Gamma-SG, 35kD Dystrophin-associated Glycoprotein, 35DAG) (FITC)

Gene Names
SGCG; A4; MAM; DMDA; SCG3; 35DAG; DAGA4; DMDA1; LGMD2C; SCARMD2; gamma-SG
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SGCG; Monoclonal Antibody; SGCG (Gamma-sarcoglycan; Gamma-SG; 35kD Dystrophin-associated Glycoprotein; 35DAG) (FITC); anti-SGCG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C5
Specificity
Recognizes human SGCG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-SGCG antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa191-291 from human SGCG (NP_0002220) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHSHIC*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Immunoprecipitation (IP)

(Immunoprecipitation of SGCG transfected lysate using SGCG monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SGCG rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of SGCG transfected lysate using SGCG monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SGCG rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged SGCG is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SGCG is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-SGCG antibody
This gene encodes gamma-sarcoglycan, one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin. The dystrophin-glycoprotein complex (DGC) spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Defects in the encoded protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).
Product Categories/Family for anti-SGCG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,379 Da
NCBI Official Full Name
gamma-sarcoglycan
NCBI Official Synonym Full Names
sarcoglycan gamma
NCBI Official Symbol
SGCG
NCBI Official Synonym Symbols
A4; MAM; DMDA; SCG3; 35DAG; DAGA4; DMDA1; LGMD2C; SCARMD2; gamma-SG
NCBI Protein Information
gamma-sarcoglycan
UniProt Protein Name
Gamma-sarcoglycan
Protein Family
UniProt Gene Name
SGCG
UniProt Synonym Gene Names
Gamma-SG; 35DAG
UniProt Entry Name
SGCG_HUMAN

NCBI Description

This gene encodes gamma-sarcoglycan, one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin. The dystrophin-glycoprotein complex (DGC) spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Defects in the encoded protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C). [provided by RefSeq, Oct 2008]

Uniprot Description

SGCG: Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix. Defects in SGCG are the cause of limb-girdle muscular dystrophy type 2C (LGMD2C). LGMD2C is characterized by progressive muscle wasting from early childhood. Belongs to the sarcoglycan beta/delta/gamma/zeta family.

Protein type: Membrane protein, integral; Dystrophin complex

Chromosomal Location of Human Ortholog: 13q12

Cellular Component: cytoskeleton; cytoplasm; plasma membrane; integral to membrane; sarcoglycan complex; sarcolemma

Molecular Function: protein binding

Biological Process: cardiac muscle development; muscle development; heart contraction; muscle cell development

Disease: Muscular Dystrophy, Limb-girdle, Type 2c

Research Articles on SGCG

Similar Products

Product Notes

The SGCG sgcg (Catalog #AAA6149625) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SGCG (Gamma-sarcoglycan, Gamma-SG, 35kD Dystrophin-associated Glycoprotein, 35DAG) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SGCG can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SGCG sgcg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SGCG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.