Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SERPINB7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: PANC1 cell lysate)

Rabbit anti-Human SERPINB7 Polyclonal Antibody | anti-SERPINB7 antibody

SERPINB7 antibody - N-terminal region

Gene Names
SERPINB7; PPKN; TP55; MEGSIN
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SERPINB7; Polyclonal Antibody; SERPINB7 antibody - N-terminal region; anti-SERPINB7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSQIDKLLHVNTASGYGNSSNSQSGLQSQLKRVFSDINASHKDYDLSIVN
Sequence Length
380
Applicable Applications for anti-SERPINB7 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SERPINB7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SERPINB7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: PANC1 cell lysate)

Western Blot (WB) (WB Suggested Anti-SERPINB7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: PANC1 cell lysate)
Related Product Information for anti-SERPINB7 antibody
This is a rabbit polyclonal antibody against SERPINB7. It was validated on Western Blot

Target Description: SERPINB7 might function as an inhibitor of Lys-specific proteases. SERPINB7 might influence the maturation of megakaryocytes via its action as a serpin.
Product Categories/Family for anti-SERPINB7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
serpin B7 isoform 1
NCBI Official Synonym Full Names
serpin family B member 7
NCBI Official Symbol
SERPINB7
NCBI Official Synonym Symbols
PPKN; TP55; MEGSIN
NCBI Protein Information
serpin B7
UniProt Protein Name
Serpin B7
Protein Family
UniProt Gene Name
SERPINB7
UniProt Entry Name
SPB7_HUMAN

NCBI Description

This gene encodes a member of a family of proteins which function as protease inhibitors. Expression of this gene is upregulated in IgA nephropathy and mutations have been found to cause palmoplantar keratoderma, Nagashima type. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014]

Uniprot Description

SERPINB7: Might function as an inhibitor of Lys-specific proteases. Might influence the maturation of megakaryocytes via its action as a serpin. Belongs to the serpin family. Ov-serpin subfamily.

Chromosomal Location of Human Ortholog: 18q21.33

Cellular Component: extracellular space; cytoplasm

Molecular Function: serine-type endopeptidase inhibitor activity

Biological Process: positive regulation of transforming growth factor-beta1 production; positive regulation of collagen biosynthetic process

Disease: Palmoplantar Keratoderma, Nagashima Type

Research Articles on SERPINB7

Similar Products

Product Notes

The SERPINB7 serpinb7 (Catalog #AAA3214250) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERPINB7 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINB7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SERPINB7 serpinb7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSQIDKLLHV NTASGYGNSS NSQSGLQSQL KRVFSDINAS HKDYDLSIVN. It is sometimes possible for the material contained within the vial of "SERPINB7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.