Western Blot (WB)
(C5ORF39 antibody (MBS839887) used at 1 ug/ml to detect target protein.)
Rabbit C5ORF39 Polyclonal Antibody | anti-C5ORF39 antibody
C5ORF39 antibody
Gene Names
ANXA2R; AX2R; AXIIR; C5orf39
Applications
Western Blot
Purity
Affinity purified
Synonyms
C5ORF39; Polyclonal Antibody; C5ORF39 antibody; Polyclonal C5ORF39; Anti-C5ORF39; AXIIR; Chromosome ORF 5; Chromosome 5 ORF; AX2R; Chromosome ORF-5; anti-C5ORF39 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
C5ORF39 antibody was raised against the N terminal Of C5Orf39
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C5ORF39 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
193
Applicable Applications for anti-C5ORF39 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
C5orf39 may act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation.
Cross-Reactivity
Human
Immunogen
C5ORF39 antibody was raised using the N terminal Of C5Orf39 corresponding to a region with amino acids EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(C5ORF39 antibody (MBS839887) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(C5ORF39 antibody (MBS839887) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C5ORF39 antibody
Rabbit polyclonal C5ORF39 antibody raised against the N terminal Of C5Orf39
Product Categories/Family for anti-C5ORF39 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
22 kDa (MW of target protein)
NCBI Official Full Name
Chromosome 5 open reading frame 39
NCBI Official Synonym Full Names
annexin A2 receptor
NCBI Official Symbol
ANXA2R
NCBI Official Synonym Symbols
AX2R; AXIIR; C5orf39
NCBI Protein Information
annexin-2 receptor
UniProt Protein Name
Annexin-2 receptor
UniProt Gene Name
ANXA2R
UniProt Synonym Gene Names
AX2R; C5orf39; AXIIR
UniProt Entry Name
AX2R_HUMAN
Uniprot Description
ANXA2R: May act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation.
Protein type: Receptor, misc.
Chromosomal Location of Human Ortholog: 5p12
Research Articles on C5ORF39
1. AXIIR acts as a novel inducer of apoptosis in human cells, partially through activating Caspase-8.
Similar Products
Product Notes
The C5ORF39 anxa2r (Catalog #AAA839887) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C5ORF39 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C5ORF39 anxa2r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C5ORF39, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
