Western Blot (WB)
(Host: RabbitTarget Name: SERPINA3GSample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse SERPINA3G Polyclonal Antibody | anti-SERPINA3G antibody
SERPINA3G Antibody - middle region
Gene Names
Serpina3g; 2A2; spi2; Spi2A; Spi2-1; AI119734; Spi2/eb.1
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
SERPINA3G; Polyclonal Antibody; SERPINA3G Antibody - middle region; anti-SERPINA3G antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GKWKNPFDPNDTFKSEFYLDEKRSVIVSMMKTGYLTTPYFRDEELSCTVV
Sequence Length
440
Applicable Applications for anti-SERPINA3G antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of mouse SERPINA3G
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SERPINA3GSample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SERPINA3GSample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SERPINA3G antibody
Serine and cysteine protease inhibitor. Can inhibit lysosomal papain-like proteases including the cathepsins B, G, H, K, L and V. Ineffective against elastase, granzyme A, granzyme B, or caspases 3, 8 or 9. Inhibition of cytoplasmic cathepsin B following release from the lysosome may protect cells from apoptosis. This may facilitate the survival of progenitor T-cells and the subsequent development of long term memory CD8 T-cells.
Product Categories/Family for anti-SERPINA3G antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49 kDa
NCBI Official Full Name
serine protease inhibitor A3G
NCBI Official Synonym Full Names
serine (or cysteine) peptidase inhibitor, clade A, member 3G
NCBI Official Symbol
Serpina3g
NCBI Official Synonym Symbols
2A2; spi2; Spi2A; Spi2-1; AI119734; Spi2/eb.1
NCBI Protein Information
serine protease inhibitor A3G
UniProt Protein Name
Serine protease inhibitor A3G
Protein Family
UniProt Gene Name
Serpina3g
UniProt Synonym Gene Names
Spi2A; Serpin A3G; Serpin 2A
Uniprot Description
Serine and cysteine protease inhibitor. Can inhibit lysosomal papain-like proteases including the cathepsins B, G, H, K, L and V. Ineffective against elastase, granzyme A, granzyme B, or caspases 3, 8 or 9. Inhibition of cytoplasmic cathepsin B following release from the lysosome may protect cells from apoptosis. This may facilitate the survival of progenitor T-cells and the subsequent development of long term memory CD8 T-cells.
Research Articles on SERPINA3G
Similar Products
Product Notes
The SERPINA3G serpina3g (Catalog #AAA3223765) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERPINA3G Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINA3G can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SERPINA3G serpina3g for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GKWKNPFDPN DTFKSEFYLD EKRSVIVSMM KTGYLTTPYF RDEELSCTVV. It is sometimes possible for the material contained within the vial of "SERPINA3G, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
