Western Blot (WB)
(Host: RabbitTarget Name: SP100Sample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse SP100 Polyclonal Antibody | anti-SP100 antibody
SP100 Antibody - C-terminal region
Gene Names
Sp100; A430075G10Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
SP100; Polyclonal Antibody; SP100 Antibody - C-terminal region; anti-SP100 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DFEIEGNCEKAKNWRQSIRCKGWTLRELIQKGVLQDPPRKKKETPRNPRQ
Sequence Length
482
Applicable Applications for anti-SP100 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse SP100
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SP100Sample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SP100Sample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SP100 antibody
Together with PML, this tumor suppressor is a major constituent of the PML bodies, a subnuclear organelle involved in a large number of physiological processes including cell growth, differentiation and apoptosis. Functions as a transcriptional coactivator of ETS1 and ETS2. Under certain conditions, it may also act as a corepressor of ETS1 preventing its binding to DNA. Through the regulation of ETS1 it may play a role in angiogenesis, controlling endothelial cell motility and invasion. Through interaction with the MRN complex it may be involved in the regulation of telomeres lengthening. May also regulate TP53-mediated transcription and through CASP8AP2, regulate FAS-mediated apoptosis. May also play a role in infection by viruses through mechanisms that may involve chromatin and/or transcriptional regulation (By similarity).
Product Categories/Family for anti-SP100 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53 kDa
NCBI Official Full Name
nuclear autoantigen Sp-100 isoform 2
NCBI Official Synonym Full Names
nuclear antigen Sp100
NCBI Official Symbol
Sp100
NCBI Official Synonym Symbols
A430075G10Rik
NCBI Protein Information
nuclear autoantigen Sp-100
UniProt Protein Name
Nuclear autoantigen Sp-100
Protein Family
UniProt Gene Name
Sp100
UniProt Entry Name
SP100_MOUSE
Research Articles on SP100
Similar Products
Product Notes
The SP100 sp100 (Catalog #AAA3224245) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SP100 Antibody - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SP100 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SP100 sp100 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DFEIEGNCEK AKNWRQSIRC KGWTLRELIQ KGVLQDPPRK KKETPRNPRQ. It is sometimes possible for the material contained within the vial of "SP100, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
