Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SELS rabbit polyclonal antibody. Western Blot analysis of SELS expression in HepG2.)

Rabbit anti-Human Selenoprotein S Polyclonal Antibody | anti-SelS antibody

Selenoprotein S (SelS, ADO15, AD-015, SBBI8, SEPS1, VCP-interacting Membrane Protein, VIMP) (AP)

Gene Names
VIMP; SELS; ADO15; SBBI8; SEPS1; AD-015
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Selenoprotein S; Polyclonal Antibody; Selenoprotein S (SelS; ADO15; AD-015; SBBI8; SEPS1; VCP-interacting Membrane Protein; VIMP) (AP); anti-SelS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SELS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SelS antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SELS, aa1-187 (NP_060915.2).
Immunogen Sequence
MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGG
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SELS rabbit polyclonal antibody. Western Blot analysis of SELS expression in HepG2.)

Western Blot (WB) (SELS rabbit polyclonal antibody. Western Blot analysis of SELS expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of SELS expression in transfected 293T cell line by SELS polyclonal antibody. Lane 1: SELS transfected lysate (21.0kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SELS expression in transfected 293T cell line by SELS polyclonal antibody. Lane 1: SELS transfected lysate (21.0kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SelS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,163 Da
NCBI Official Full Name
selenoprotein S isoform 2
NCBI Official Synonym Full Names
VCP interacting membrane selenoprotein
NCBI Official Symbol
VIMP
NCBI Official Synonym Symbols
SELS; ADO15; SBBI8; SEPS1; AD-015
NCBI Protein Information
selenoprotein S
UniProt Protein Name
Selenoprotein S
Protein Family
UniProt Gene Name
VIMP
UniProt Synonym Gene Names
SELS; SelS
UniProt Entry Name
SELS_HUMAN

NCBI Description

This gene encodes a member of the selenoprotein family, characterized by a selenocysteine (Sec) residue at the active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Studies suggest that this protein may regulate cytokine production, and thus play a key role in the control of the inflammatory response. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2013]

Uniprot Description

SELS: Involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner. Probably acts by serving as a linker between DERL1, which mediates the retrotranslocation of misfolded proteins into the cytosol, and the ATPase complex VCP, which mediates the translocation and ubiquitination. Belongs to the selenoprotein S family.

Protein type: Membrane protein, integral; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 15q26.3

Cellular Component: cytoplasmic microtubule; endoplasmic reticulum; integral to endoplasmic reticulum membrane; plasma membrane

Molecular Function: antioxidant activity; ATPase binding; enzyme binding; protein binding; receptor activity

Biological Process: cell redox homeostasis; cellular response to insulin stimulus; ER overload response; ER-associated protein catabolic process; establishment of protein localization; negative regulation of acute inflammatory response to antigenic stimulus; negative regulation of glucose import; negative regulation of glycogen biosynthetic process; negative regulation of inflammatory response; negative regulation of interleukin-6 production; negative regulation of nitric-oxide synthase biosynthetic process; negative regulation of tumor necrosis factor production; regulation of gluconeogenesis; response to glucose stimulus; response to redox state; retrograde protein transport, ER to cytosol; unfolded protein response

Research Articles on SelS

Similar Products

Product Notes

The SelS vimp (Catalog #AAA6393541) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Selenoprotein S (SelS, ADO15, AD-015, SBBI8, SEPS1, VCP-interacting Membrane Protein, VIMP) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Selenoprotein S can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SelS vimp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Selenoprotein S, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.