Rabbit anti-Human Selenoprotein S Polyclonal Antibody | anti-SelS antibody

Selenoprotein S (SelS, ADO15, AD-015, SBBI8, SEPS1, VCP-interacting Membrane Protein, VIMP) (PE)

Cat. Num. AAA6393551

• Gene Names: VIMP; SELS; ADO15; SBBI8; SEPS1; AD-015
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Selenoprotein S; Polyclonal Antibody; Selenoprotein S (SelS; ADO15; AD-015; SBBI8; SEPS1; VCP-interacting Membrane Protein; VIMP) (PE); anti-SelS antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SELS.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-SelS antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human SELS, aa1-187 (NP_060915.2).
• Immunogen Sequence: MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGG
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SELS rabbit polyclonal antibody. Western Blot analysis of SELS expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of SELS expression in transfected 293T cell line by SELS polyclonal antibody. Lane 1: SELS transfected lysate (21.0kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-SelS antibody

Antibodies; Selenoprotein

NCBI and Uniprot Product Information

• NCBI GI #: 33285002
• NCBI GeneID: 55829
• NCBI Accession #: NP_060915.2
• NCBI GenBank Nucleotide #: NM_018445
• UniProt Accession #: Q9BQE4; Q3B771; Q9P0I6
• Molecular Weight: 21,163 Da
• NCBI Official Full Name: selenoprotein S isoform 2
• NCBI Official Synonym Full Names: VCP interacting membrane selenoprotein
• NCBI Official Symbol: VIMP
• NCBI Official Synonym Symbols: SELS; ADO15; SBBI8; SEPS1; AD-015
• NCBI Protein Information: selenoprotein S
• UniProt Protein Name: Selenoprotein S
• Protein Family: Selenoprotein
• UniProt Gene Name: VIMP
• UniProt Synonym Gene Names: SELS; SelS
• UniProt Entry Name: SELS_HUMAN

NCBI Description

This gene encodes a member of the selenoprotein family, characterized by a selenocysteine (Sec) residue at the active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Studies suggest that this protein may regulate cytokine production, and thus play a key role in the control of the inflammatory response. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2013]

Uniprot Description

SELS: Involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner. Probably acts by serving as a linker between DERL1, which mediates the retrotranslocation of misfolded proteins into the cytosol, and the ATPase complex VCP, which mediates the translocation and ubiquitination. Belongs to the selenoprotein S family.

Protein type: Membrane protein, integral; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 15q26.3

Cellular Component: cytoplasmic microtubule; endoplasmic reticulum; integral to endoplasmic reticulum membrane; plasma membrane

Molecular Function: antioxidant activity; ATPase binding; enzyme binding; protein binding; receptor activity

Biological Process: cell redox homeostasis; cellular response to insulin stimulus; ER overload response; ER-associated protein catabolic process; establishment of protein localization; negative regulation of acute inflammatory response to antigenic stimulus; negative regulation of glucose import; negative regulation of glycogen biosynthetic process; negative regulation of inflammatory response; negative regulation of interleukin-6 production; negative regulation of nitric-oxide synthase biosynthetic process; negative regulation of tumor necrosis factor production; regulation of gluconeogenesis; response to glucose stimulus; response to redox state; retrograde protein transport, ER to cytosol; unfolded protein response