Western Blot (WB)
(Host: MouseTarget Name: SEC23BSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)
Rabbit SEC23B Polyclonal Antibody | anti-SEC23B antibody
SEC23B antibody - middle region
Gene Names
SEC23B; CWS7; CDAII; CDAN2; CDA-II; HEMPAS; hSec23B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SEC23B; Polyclonal Antibody; SEC23B antibody - middle region; anti-SEC23B antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SFSLYPQFMFHLRRSPFLQVFNNSPDESSYYRHHFARQDLTQSLIMIQPI
Sequence Length
767
Applicable Applications for anti-SEC23B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SEC23B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: MouseTarget Name: SEC23BSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: MouseTarget Name: SEC23BSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-SEC23B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: CCRF-CEM cell lysateThere is BioGPS gene expression data showing that SEC23B is expressed in CCRT-CEM)
Western Blot (WB)
(WB Suggested Anti-SEC23B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: CCRF-CEM cell lysateThere is BioGPS gene expression data showing that SEC23B is expressed in CCRT-CEM)
Related Product Information for anti-SEC23B antibody
This is a rabbit polyclonal antibody against SEC23B. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SEC23B is a member of the SEC23 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. SEC23B has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The function SEC23B has been implicated in cargo selection and concentration.The protein encoded by this gene is a member of the SEC23 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The function of this gene product has been implicated in cargo selection and concentration. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
Target Description: SEC23B is a member of the SEC23 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. SEC23B has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The function SEC23B has been implicated in cargo selection and concentration.The protein encoded by this gene is a member of the SEC23 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The function of this gene product has been implicated in cargo selection and concentration. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-SEC23B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
protein transport protein Sec23B isoform 1
NCBI Official Synonym Full Names
Sec23 homolog B, coat complex II component
NCBI Official Symbol
SEC23B
NCBI Official Synonym Symbols
CWS7; CDAII; CDAN2; CDA-II; HEMPAS; hSec23B
NCBI Protein Information
protein transport protein Sec23B
UniProt Protein Name
Protein transport protein Sec23B
Protein Family
UniProt Gene Name
SEC23B
UniProt Entry Name
SC23B_HUMAN
NCBI Description
The protein encoded by this gene is a member of the SEC23 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The function of this gene product has been implicated in cargo selection and concentration. Multiple alternatively spliced transcript variants have been identified in this gene. [provided by RefSeq, Feb 2010]
Research Articles on SEC23B
Similar Products
Product Notes
The SEC23B sec23b (Catalog #AAA3210642) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SEC23B antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SEC23B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SEC23B sec23b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SFSLYPQFMF HLRRSPFLQV FNNSPDESSY YRHHFARQDL TQSLIMIQPI. It is sometimes possible for the material contained within the vial of "SEC23B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
