Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SEC13 expression in transfected 293T cell line by SEC13 polyclonal antibody. Lane 1: SEC13 transfected lysate (35.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SEC13 Polyclonal Antibody | anti-SEC13 antibody

SEC13 (Protein SEC13 Homolog, SEC13-like Protein 1, SEC13-related Protein, D3S1231E, SEC13L1, SEC13R) (Biotin)

Gene Names
SEC13; SEC13R; npp-20; SEC13L1; D3S1231E
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SEC13; Polyclonal Antibody; SEC13 (Protein SEC13 Homolog; SEC13-like Protein 1; SEC13-related Protein; D3S1231E; SEC13L1; SEC13R) (Biotin); anti-SEC13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SEC13.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
322
Applicable Applications for anti-SEC13 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SEC13, aa1-322 (NP_899195.1).
Immunogen Sequence
MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SEC13 expression in transfected 293T cell line by SEC13 polyclonal antibody. Lane 1: SEC13 transfected lysate (35.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SEC13 expression in transfected 293T cell line by SEC13 polyclonal antibody. Lane 1: SEC13 transfected lysate (35.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SEC13 antibody
Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles.
Product Categories/Family for anti-SEC13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
protein SEC13 homolog isoform 1
NCBI Official Synonym Full Names
SEC13 homolog, nuclear pore and COPII coat complex component
NCBI Official Symbol
SEC13
NCBI Official Synonym Symbols
SEC13R; npp-20; SEC13L1; D3S1231E
NCBI Protein Information
protein SEC13 homolog
UniProt Protein Name
Protein SEC13 homolog
Protein Family
UniProt Gene Name
SEC13
UniProt Synonym Gene Names
D3S1231E; SEC13L1; SEC13R
UniProt Entry Name
SEC13_HUMAN

NCBI Description

The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq, Oct 2008]

Uniprot Description

SEC13: Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles. Belongs to the WD repeat SEC13 family.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3p25-p24

Cellular Component: kinetochore; Golgi membrane; endoplasmic reticulum membrane; nuclear envelope; cytosol

Molecular Function: protein binding

Biological Process: COPII coating of Golgi vesicle; intracellular protein transport; antigen processing and presentation of peptide antigen via MHC class I; ER to Golgi vesicle-mediated transport; mRNA transport; cellular protein metabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class II; protein amino acid N-linked glycosylation via asparagine; mitotic cell cycle; post-translational protein modification

Research Articles on SEC13

Similar Products

Product Notes

The SEC13 sec13 (Catalog #AAA6393521) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SEC13 (Protein SEC13 Homolog, SEC13-like Protein 1, SEC13-related Protein, D3S1231E, SEC13L1, SEC13R) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SEC13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SEC13 sec13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SEC13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.