Mouse anti-Human SEC13 Monoclonal Antibody | anti-SEC13 antibody

SEC13 (Protein SEC13 Homolog, SEC13-like Protein 1, SEC13-related Protein, D3S1231E, SEC13L1, SEC13R) (HRP)

Cat. Num. AAA6154862

• Gene Names: SEC13; SEC13R; npp-20; SEC13L1; D3S1231E
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SEC13; Monoclonal Antibody; SEC13 (Protein SEC13 Homolog; SEC13-like Protein 1; SEC13-related Protein; D3S1231E; SEC13L1; SEC13R) (HRP); anti-SEC13 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1G7
• Specificity: Recognizes human SEC13.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 325

• Applicable Applications for anti-SEC13 antibody: ELISA (EIA), Immunoprecipitation (IP)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa226-325 from human SEC13 (NP_109598) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNE*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(mmunoprecipitation of SEC13 transfected lysate using SEC13 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SEC13 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged SEC13 is 0.03ng/ml as a capture antibody.)

Related Product Information for anti-SEC13 antibody

Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles.

Product Categories/Family for anti-SEC13 antibody

Antibodies; Transport Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 34335136
• NCBI GeneID: 6396
• NCBI Accession #: NP_109598
• NCBI GenBank Nucleotide #: NM_030673
• UniProt Accession #: P55735
• NCBI Official Full Name: protein SEC13 homolog isoform 4
• NCBI Official Synonym Full Names: SEC13 homolog, nuclear pore and COPII coat complex component
• NCBI Official Symbol: SEC13
• NCBI Official Synonym Symbols: SEC13R; npp-20; SEC13L1; D3S1231E
• NCBI Protein Information: protein SEC13 homolog
• UniProt Protein Name: Protein SEC13 homolog
• Protein Family: Protein transport protein
• UniProt Gene Name: SEC13
• UniProt Synonym Gene Names: D3S1231E; SEC13L1; SEC13R
• UniProt Entry Name: SEC13_HUMAN

NCBI Description

The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq, Oct 2008]

Uniprot Description

SEC13: Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles. Belongs to the WD repeat SEC13 family.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3p25-p24

Cellular Component: kinetochore; Golgi membrane; endoplasmic reticulum membrane; nuclear envelope; cytosol

Molecular Function: protein binding

Biological Process: COPII coating of Golgi vesicle; intracellular protein transport; antigen processing and presentation of peptide antigen via MHC class I; ER to Golgi vesicle-mediated transport; mRNA transport; cellular protein metabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class II; protein amino acid N-linked glycosylation via asparagine; mitotic cell cycle; post-translational protein modification