Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SDF4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)
Rabbit anti-Mouse, Rat SDF4 Polyclonal Antibody | anti-SDF4 antibody
SDF4 Polyclonal Antibody
Gene Names
SDF4; Cab45; SDF-4
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
SDF4; Polyclonal Antibody; SDF4 Polyclonal Antibody; Cab45; SDF-4; anti-SDF4 antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
RPANHSSTRERVANREENEILPPDHLNGVKLEMDGHLNRGFHQEVFLGKDLGGFDEDAEPRRSRRKLMVIFSKVDVNTDRKISAKEMQRWIMEKTAEHFQEAMEESKTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEETQEVLENL
Sequence Length
362
Applicable Applications for anti-SDF4 antibody
Western Blot (WB)
Application Notes
WB: 1:200 - 1:2000
Immunogen
Recombinant protein of human SDF4
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell projection, Cytoplasm, Golgi apparatus lumen, bleb
Positive Samples
Mouse brain, Mouse kidney, Mosue liver, Mouse pancreas, Rat heart
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SDF4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SDF4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)
Related Product Information for anti-SDF4 antibody
This gene encodes a stromal cell derived factor that is a member of the CREC protein family. The encoded protein contains six EF-hand motifs and calcium-binding motifs. This protein localizes to the Golgi lumen and may be involved in regulating calcium dependent cellular activities.
Product Categories/Family for anti-SDF4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 15kDa; 23kDa; 27kDa; 30kDa; 39kDa; 41kDa
Observed: 45kDa
Observed: 45kDa
NCBI Official Full Name
45 kDa calcium-binding protein isoform 2
NCBI Official Synonym Full Names
stromal cell derived factor 4
NCBI Official Symbol
SDF4
NCBI Official Synonym Symbols
Cab45; SDF-4
NCBI Protein Information
45 kDa calcium-binding protein
UniProt Protein Name
45 kDa calcium-binding protein
Protein Family
UniProt Gene Name
SDF4
UniProt Synonym Gene Names
CAB45; Cab45; SDF-4
NCBI Description
This gene encodes a stromal cell derived factor that is a member of the CREC protein family. The encoded protein contains six EF-hand motifs and calcium-binding motifs. This protein localizes to the Golgi lumen and may be involved in regulating calcium dependent cellular activities. [provided by RefSeq, Sep 2011]
Uniprot Description
May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.
Research Articles on SDF4
Similar Products
Product Notes
The SDF4 sdf4 (Catalog #AAA9135430) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SDF4 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SDF4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:200 - 1:2000. Researchers should empirically determine the suitability of the SDF4 sdf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RPANHSSTRE RVANREENEI LPPDHLNGVK LEMDGHLNRG FHQEVFLGKD LGGFDEDAEP RRSRRKLMVI FSKVDVNTDR KISAKEMQRW IMEKTAEHFQ EAMEESKTHF RAVDPDGDGH VSWDEYKVKF LASKGHSEKE VADAIRLNEE LKVDEETQEV LENL. It is sometimes possible for the material contained within the vial of "SDF4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
