SDS-PAGE
Interleukin-8 Recombinant Protein | IL8 recombinant protein
Recombinant Dog Interleukin-8
Gene Names
CXCL8; IL8
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-8; Recombinant Dog Interleukin-8; C-X-C motif chemokine hemokine (C-X-C motif) ligand 8; IL8 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-101aa; Full Length
Sequence
AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
Sequence Length
101
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for IL8 recombinant protein
IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
References
Cloning of a canine gene homologous to the human interleukin-8-encoding gene.Ishikawa J., Suzuki S., Hotta K., Hirota Y., Mizuno S., Suzuki K.Gene 131:305-306(1993)
Molecular cloning and expression of canine interleukin 8 cDNA.Matsumoto Y., Mohamed A., Onodera T., Kato H., Ohashi T., Goitsuka R., Tsujimoto H., Hasegawa A., Furusawa S., Yoshihara K., Ishikawa J., Hotta K., Suzuki K., Hirota Y.Cytokine 6:455-461(1994)
Interleukin-8 gene induction in the myocardium after ischemia and reperfusion in vivo.Kukielka G.L., Smith W.C., Larosa G.J., Manning A.M., Mendoza L.H., Daly T.J., Hughes B.J., Youker K.A., Hawkins H.K., Michael L.H., Rot A., Entman M.L.J. Clin. Invest. 95:89-103(1995)
Borrelia burgdorferi migrates into joint capsules and causes an up-regulation of interleukin-8 in synovial membranes of dogs experimentally infected with ticks.Straubinger R.K., Straubinger A.F., Harter L., Jacobson R.H., Chang Y.-F., Summers B.A., Erb H.N., Appel M.J.Infect. Immun. 65:1273-1285(1997)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11.1 kDa
NCBI Official Full Name
interleukin-8
NCBI Official Symbol
CXCL8
NCBI Official Synonym Symbols
IL8
NCBI Protein Information
interleukin-8
UniProt Protein Name
Interleukin-8
Protein Family
UniProt Gene Name
CXCL8
UniProt Synonym Gene Names
IL8; IL-8
UniProt Entry Name
IL8_CANLF
Uniprot Description
IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Research Articles on IL8
Similar Products
Product Notes
The IL8 cxcl8 (Catalog #AAA957453) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-101aa; Full Length. The amino acid sequence is listed below: AVLSRVSSEL RCQCIKTHST PFHPKYIKEL RVIDSGPHCE NSEIIVKLFN GNEVCLDPKE KWVQKVVQIF LKKAEKQDP. It is sometimes possible for the material contained within the vial of "Interleukin-8, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
